DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and Ptpn20

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_006518791.1 Gene:Ptpn20 / 19256 MGIID:1196295 Length:463 Species:Mus musculus


Alignment Length:311 Identity:88/311 - (28%)
Similarity:130/311 - (41%) Gaps:66/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1110 DVFEEFRDVPQIIARADEVPPG----CEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRG 1170
            |:..||.::.| :...|:...|    ..|||||.:::|...|||.|.:..|     ||||:|:|.
Mouse   201 DIIREFLELEQ-MTLPDDFNSGNTLQNRDKNRYRDILPYDSTRVPLGKNKD-----YINASYIRI 259

  Fly  1171 PRDAPNY-YIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEYLPPSATLDNHSSY 1234
            ......| |||.|.||..|..|||:|:.|....||...|...|.|:.:|..|.|.|  |.....:
Mouse   260 VNHEEEYFYIATQGPLPETIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPIS--LKEPLEF 322

  Fly  1235 GDYQVTLKHREVKDRYAISTLVLKRVDGEESRELTHYWY-KWPEAGVPAEEAPIIAMLLEARSSL 1298
            ..:.|.|:...|...:.:....:.:....:|:.:.|..: |||:.|.||.               
Mouse   323 EHFSVFLETFHVTQYFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPAS--------------- 372

  Fly  1299 KSYSLEQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTG 1363
            ..:.::....:|:...|                                    |||.||||.|.|
Mouse   373 ADFFIKYVRYVRKSHIT------------------------------------GPLLVHCSAGVG 401

  Fly  1364 RTGTIIASDMAIRSLETPKRSVDIPQLVYYVRRGRASAVQTKEQYEFIYKV 1414
            |||..|..|:...::| ...|.||..:|..:|:.|...:||||||:|.|::
Mouse   402 RTGVFICVDVVFSAIE-KNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEI 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 82/283 (29%)
Y_phosphatase 1134..1415 CDD:278528 82/283 (29%)
Ptpn20XP_006518791.1 PTP_DSP_cys 251..457 CDD:391942 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.