DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and hpo-7

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_494193.1 Gene:hpo-7 / 183354 WormBaseID:WBGene00016548 Length:285 Species:Caenorhabditis elegans


Alignment Length:224 Identity:44/224 - (19%)
Similarity:77/224 - (34%) Gaps:85/224 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1211 SENGIERCAEYL----PPSATLDNHSS------------YGDY---QVTLKHREVKDRYAISTLV 1256
            |.:.::.||:.:    ||.:|:|....            .||:   .|.|:..|:...::.|.  
 Worm    16 SVDDVDECAQGVEPSRPPYSTMDKFLQMIVQTKATDVVMLGDFYENDVVLRTIEITSNFSKSK-- 78

  Fly  1257 LKRVDGEESRELTHYWYKWPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSATLETSMD 1321
                  :|:..:.||:||                                               
 Worm    79 ------KETHTIRHYFYK----------------------------------------------- 90

  Fly  1322 ADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTIIASDMAIRSL-----ETP 1381
              |..|:.|...|.||.....:...::|    :.||||.|.||......:::|.:::     :||
 Worm    91 --GWIAQNGPELSREILNVFKAVRKSKS----VVVHCSTGIGRAAAFAFTELAYQTMMLNMRQTP 149

  Fly  1382 KRSVDIPQLVYYVRRGRASAVQTKEQYEF 1410
            ...:|..:|:..:|..||.|:.|..|..|
 Worm   150 TVGLDYVKLIQDLRSMRAGAIYTPMQLAF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 44/224 (20%)
Y_phosphatase 1134..1415 CDD:278528 44/224 (20%)
hpo-7NP_494193.1 PTPc 1..178 CDD:304379 43/222 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.