DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and C17H12.5

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_501047.1 Gene:C17H12.5 / 182754 WormBaseID:WBGene00015931 Length:443 Species:Caenorhabditis elegans


Alignment Length:289 Identity:54/289 - (18%)
Similarity:95/289 - (32%) Gaps:88/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1158 DKTEYINANYVRGPRDAPNY--------------YIACQAPLESTTSDFWRMIWEQQSRV--IIQ 1206
            |....:::..|:.|....:|              .:..|.|......:|||..:.:...:  ::.
 Worm   187 DNYPILDSTIVKNPAQPDSYVNMSSVIVPHCRYPILMAQMPKRGFEEEFWRAAFNESVVIMYVLM 251

  Fly  1207 ATDLSENGIERCAEYLPPSATLDNHSSYGDYQVTLKHREVKD----RYAISTLVLKRVDGEESRE 1267
            .|:..:|      ::.|  .|:..:..||...|.::..|..|    ||.|..|    .:|..:..
 Worm   252 GTEDEKN------DFFP--TTMGAYVYYGAMFVNIRKVEKMDEERTRYTIEVL----PNGFSNSV 304

  Fly  1268 LTHYWYK--WPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSATLETSMDADGSKAEAG 1330
            :.:.:..  |..:|||                     :..||..|                    
 Worm   305 MMNVYVHTGWEASGVP---------------------VRYANTTR-------------------- 328

  Fly  1331 STSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTIIASDMAIRSL---ETPKRSVDIPQLVY 1392
              |..::...:.:.|||..    :.|....|.||.|..::...|...|   ..|:    |.::|.
 Worm   329 --SVVDVMNFVKTSSGTEK----MLVVSKNGCGRAGFFLSLGAAFCCLNDNSEPR----IGEIVK 383

  Fly  1393 YVRRGRASAVQTKEQYEFIYKVASMYAAK 1421
            .:|..|.:||.:.:||..||.....|..|
 Worm   384 AIRSQRPNAVDSIKQYASIYLCFVYYIKK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 52/281 (19%)
Y_phosphatase 1134..1415 CDD:278528 52/281 (19%)
C17H12.5NP_501047.1 PTPc 155..408 CDD:214550 52/283 (18%)
PTPc 193..405 CDD:304379 51/274 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.