DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and R09E10.2

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_501894.2 Gene:R09E10.2 / 177919 WormBaseID:WBGene00011172 Length:198 Species:Caenorhabditis elegans


Alignment Length:178 Identity:36/178 - (20%)
Similarity:70/178 - (39%) Gaps:45/178 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SDMFSSQ-TNIEDEKSAKTVDQTETQTASPKENLNVKQTTAAFEKNESSNTTESHLNGAQVDPVK 129
            ||:...| .|::..|:.|..|. :::.:.|         |..|.:.:|..|.:|           
 Worm    52 SDLIGQQIANLQKGKAPKANDD-KSKGSMP---------TVEFSRTQSMTTQQS----------- 95

  Fly   130 ELKDTETSADTV------KEESSTTTTSQLDQNPT--NVTDKKSTEAQFKDERLSKEILSTTTEQ 186
             |:|.:|..:.|      |.:.|:...:.|.:.||  .:...|:.:...:||...|:...     
 Worm    96 -LEDDDTQRENVPLEKKKKGKYSSEYANLLVEKPTRYRLVPSKNVKVVPEDELPKKKFDK----- 154

  Fly   187 ILLTEKALQKYVVI----TNSPLRGEAQPEIKDK-TSKSATSEKSTLP 229
                ::..::||.|    :..|:..|::...|:| .:|..:.|....|
 Worm   155 ----DRKRREYVEIGKLYSKEPIIDESEVLKKEKGNTKRRSKETDRAP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006
Y_phosphatase 1134..1415 CDD:278528
R09E10.2NP_501894.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.