DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARSD and Sgsh

DIOPT Version :9

Sequence 1:NP_001660.2 Gene:ARSD / 414 HGNCID:717 Length:593 Species:Homo sapiens
Sequence 2:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster


Alignment Length:615 Identity:138/615 - (22%)
Similarity:209/615 - (33%) Gaps:175/615 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    22 LFLCLLLKTCEPKTANAFKPNILLIMADDLGTGDLGCYGNNTLRTPNIDQLAEEGVRLTQHLAAA 86
            :|...|:..|     :|...|:||::|||.|. :.|.|.|...:|||:|.||:.|:.......:.
  Fly     7 IFTLWLIAGC-----SAGPQNVLLLLADDAGF-ESGAYLNKFCQTPNLDALAKRGLLFNNAFTSV 65

Human    87 PLCTPSRAAFLTGRHSFRSGM-DASNGYRALQWNAGSGGLPE--NETTFARILQQHGYATGLIGK 148
            ..|:|||:..|||:....||| ....|.........:|.||.  .:.:..|||      :|:|||
  Fly    66 SSCSPSRSQLLTGQAGHSSGMYGLHQGVHNFNVLPDTGSLPNLIRDQSGGRIL------SGIIGK 124

Human   149 WHQGVNCASRGDHCHHPLNHGFDYF---------YGMPFTLTNDCDPGRPPEVDAALRAQLWGYT 204
            .|.|.....|.|.......|..:..         |...| |....|..:|               
  Fly   125 KHVGAANNFRFDFEQTEEQHSINQIGRNITRMKEYARQF-LKQAKDEKKP--------------- 173

Human   205 QFLALGILTLAAGQTCGFFSVSARAVTGMAGVGCLFFISWYSSFGFVRRWNCIL--MRNHDVTEQ 267
            .||.:|   ......||.       :|...|..|..:.|.....|.:..|..|.  .||.||   
  Fly   174 FFLMVG---FHDPHRCGH-------ITPQFGEFCERWGSGEEGMGSIPDWKPIYYDWRNLDV--- 225

Human   268 PMVLEKTASLMLKEAVSYIERHKHGPFLLFLSLLHVHIPLVTTSAFLGKSQHGLYGDNVEEMDWL 332
            |..|..|..:..:.|..|:                                      .:..:|..
  Fly   226 PAWLPDTDVVRQELAAQYM--------------------------------------TISRLDQG 252

Human   333 IGKVLNAIEDNGLKNSTFTYFTSDHGGHLEARDGHSQLGGWNGIYKGGKGMGGWEGGIRVPGIFH 397
            :|.:|..:|..|:.:.|...:|||:|....        ||...:|         |.|||.|.|..
  Fly   253 VGLMLKELEAAGVADQTLVIYTSDNGPPFP--------GGRTNLY---------EHGIRSPLIIS 300

Human   398 WPG------VLPAGRVIGEPTSLMDVFPTVVQLVGGEVPQDRVIDGHSLVPLLQGAE-------- 448
            .|.      ...|..|     ||:|::|:|:..:....|.|..|.|.|::|:|:...        
  Fly   301 SPNKEDRHHEATAAMV-----SLLDIYPSVMDALQIPRPNDTKIVGRSILPVLREEPPIKESDSV 360

Human   449 --ARSAHEFLFHYCGQHLHAARWHQKDSGSVW------KVHYTTPQFHPEGAGACYGRGVCPCSG 505
              :.|.||....|..:.:...|:....:.:.|      :..||:|.|. :...|...:...|...
  Fly   361 FGSHSYHEVTMAYPMRMVRNRRYKLIHNINYWADFPIDQDFYTSPTFQ-QILNATLRKQTLPWYR 424

Human   506 EGVTHHRPP--LLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNIL 568
            ..:.:::.|  .|:|:..||.|...|                |..:::..||..:.:|.....:.
  Fly   425 SLLQYYQRPEWELYDIKTDPLERFNL----------------ADKAKYNGTLKQLREQLFDWQVA 473

Human   569 WK-PWL---------------QPCC---GH 579
            .| ||.               ||.|   ||
  Fly   474 TKDPWRCAPHAVLQEQGVYKDQPVCLTLGH 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARSDNP_001660.2 ALP_like 40..563 CDD:304875 126/560 (23%)
AslA 40..525 CDD:225661 120/522 (23%)
SgshNP_650760.1 AslA 17..476 CDD:225661 127/571 (22%)
SGSH 22..471 CDD:293751 126/561 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.