DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elp1 and irld-2

DIOPT Version :9

Sequence 1:NP_001262478.1 Gene:Elp1 / 41399 FlyBaseID:FBgn0037926 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_510227.1 Gene:irld-2 / 184077 WormBaseID:WBGene00008518 Length:310 Species:Caenorhabditis elegans


Alignment Length:249 Identity:47/249 - (18%)
Similarity:79/249 - (31%) Gaps:95/249 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GASDIYFVVADNKIYA-----------VQESGD--VRLKVIADLPDI------VGVEFLQLDNA- 74
            |.||     |.|.:||           :|.:|.  .||...|.|..:      :.|:|:..:|: 
 Worm    54 GGSD-----AINTLYAKLAYVEEVNGCIQVTGTSYTRLDFFARLRSVTCTNTTLSVDFMVSNNSA 113

  Fly    75 ---------------------ICVASGAGEVILVDPQTGATSEGTFCD--VGI-ESMAWSPNQ-- 113
                                 :|:.:.... ...:.|.||....|.|.  .|: :..:.:||.  
 Worm   114 LERLGMPVLRVNRLGLTFNPKLCITTEESS-RYTNVQRGAADNFTACQGRAGVLKECSSTPNGVN 177

  Fly   114 -------EVVA------------------FVTRTHNVVLMTSTF----------DVIAEQP-LDA 142
                   |::.                  :|...:..|.:.||.          .|.|.:| ...
 Worm   178 GGLPDDCELITGNLYVDGASNANITTKLQYVKEVYGRVYIRSTTLSNLTIPLLEKVYASEPTAST 242

  Fly   143 ELDPDQQFVNVGWGKKETQFHGSEGKQAAKQK----ESDSTFIRDEQELNQFTP 192
            .|||.   :||......|:....:....||..    .||::::.|:...||.:|
 Worm   243 TLDPT---INVASNMNFTKLSVPKINFMAKNDLSFLTSDASYVMDQDLCNQLSP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elp1NP_001262478.1 IKI3 1..887 CDD:282600 47/249 (19%)
COG5290 13..1207 CDD:227610 47/249 (19%)
irld-2NP_510227.1 Recep_L_domain 43..141 CDD:279382 17/91 (19%)
Recep_L_domain 183..>264 CDD:279382 14/83 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.