DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and AT5G45780

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_199390.2 Gene:AT5G45780 / 834618 AraportID:AT5G45780 Length:614 Species:Arabidopsis thaliana


Alignment Length:251 Identity:80/251 - (31%)
Similarity:117/251 - (46%) Gaps:42/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   806 IGKGEFGDVMLGILRN-EKVAVKMLKD---EGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHL 866
            :|:|.||.|..|.|.| ..||||.|||   .|.|| |..|..::....|.||::..|...|.:..
plant   306 LGQGGFGMVYKGYLPNGTVVAVKRLKDPIYTGEVQ-FQTEVEMIGLAVHRNLLRLFGFCMTPEER 369

  Fly   867 YLVTEYMSKGSLVDYLRSR--GRQHITKKDQIIFAYDTASGMEYLEAK---KVVHRDLAARNVLI 926
            .||..||..||:.|.||..  .:..:....:|..|...|.|:.||..:   |::|||:.|.|:|:
plant   370 MLVYPYMPNGSVADRLRDNYGEKPSLDWNRRISIALGAARGLVYLHEQCNPKIIHRDVKAANILL 434

  Fly   927 SEDCVAKVSDFGLAR----EECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFG 987
            .|...|.|.|||||:    .:.:.....:..|...|||.|..|:.|.|:|::.||:|:.|:.:  
plant   435 DESFEAIVGDFGLAKLLDQRDSHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGVLILELIT-- 497

  Fly   988 RVPYPRIPLADVVKHVEVGYKM-EAPEGCPPEIYEMMRQAW--DLNPAKRPTFAEL 1040
                              |:|| :...|   ::.:.|..:|  .|...||  |||:
plant   498 ------------------GHKMIDQGNG---QVRKGMILSWVRTLKAEKR--FAEM 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 80/251 (32%)
STYKc 800..1044 CDD:214568 80/251 (32%)
AT5G45780NP_199390.2 PLN00113 39..>192 CDD:215061
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..176 CDD:275380
PKc_like 306..574 CDD:419665 80/251 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.