DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and AT5G38210

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001331338.1 Gene:AT5G38210 / 833803 AraportID:AT5G38210 Length:698 Species:Arabidopsis thaliana


Alignment Length:222 Identity:70/222 - (31%)
Similarity:114/222 - (51%) Gaps:25/222 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 IPEAELQLRESIGKGEFGDVMLGILRNEK-VAVKMLKDEG--AVQKFLAEASVMTTLEHDNLVKF 856
            :.||.....:.:|.|.||.|..|.|::.: ||||.|.:..  .|::|..|..::.:|:|.|||..
plant   365 LEEATENFSKELGDGGFGTVYYGTLKDGRAVAVKRLFERSLKRVEQFKNEIDILKSLKHPNLVIL 429

  Fly   857 IGLVFTSKH---LYLVTEYMSKGSLVDYLRSRGRQH--ITKKDQIIFAYDTASGMEYLEAKKVVH 916
            .|.  |::|   |.||.||:|.|:|.::|.....|.  |....::..|.:|||.:.||.|..::|
plant   430 YGC--TTRHSRELLLVYEYISNGTLAEHLHGNQAQSRPICWPARLQIAIETASALSYLHASGIIH 492

  Fly   917 RDLAARNVLISEDCVAKVSDFGLAREECYNLDVGKLPIK------WTAPEALKNGRFSNKSDMWS 975
            ||:...|:|:..:...||:||||:|  .:.:|...:...      :..||..:..|.:.|||::|
plant   493 RDVKTTNILLDSNYQVKVADFGLSR--LFPMDQTHISTAPQGTPGYVDPEYYQCYRLNEKSDVYS 555

  Fly   976 FGILLWEIYSFGRVPYPRIPLADVVKH 1002
            ||::|.|:.|....       .|:.:|
plant   556 FGVVLSELISSKEA-------VDITRH 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 70/222 (32%)
STYKc 800..1044 CDD:214568 68/217 (31%)
AT5G38210NP_001331338.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1899
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.