DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and NIK1

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_197104.1 Gene:NIK1 / 831457 AraportID:AT5G16000 Length:638 Species:Arabidopsis thaliana


Alignment Length:297 Identity:89/297 - (29%)
Similarity:141/297 - (47%) Gaps:43/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   773 LPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNEK-VAVKMLKDEGAVQ 836
            |.:.|.:|..|.:.:|..|            ..:|||.:|:|..|||.:.. ||||.|||.||:.
plant   297 LRRFGFRELQIATNNFSSK------------NLLGKGGYGNVYKGILGDSTVVAVKRLKDGGALG 349

  Fly   837 ---KFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIF 898
               :|..|..:::...|.||::..|...|.....||..|||.||:...::::.....:.:.:|  
plant   350 GEIQFQTEVEMISLAVHRNLLRLYGFCITQTEKLLVYPYMSNGSVASRMKAKPVLDWSIRKRI-- 412

  Fly   899 AYDTASGMEYLEAK---KVVHRDLAARNVLISEDCVAKVSDFGLAR----EECYNLDVGKLPIKW 956
            |...|.|:.||..:   |::|||:.|.|:|:.:.|.|.|.|||||:    ::.:.....:..:..
plant   413 AIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVTTAVRGTVGH 477

  Fly   957 TAPEALKNGRFSNKSDMWSFGILLWEI------YSFGRVPYPRIPLADVVKHVEVGYKMEA---P 1012
            .|||.|..|:.|.|:|::.|||||.|:      :.||:....:..:.|.||.:....|:|.   .
plant   478 IAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVKKIHQEKKLELLVDK 542

  Fly  1013 EGCPPEIY------EMMRQA---WDLNPAKRPTFAEL 1040
            |....:.|      ||:|.|   ....|..||..:|:
plant   543 ELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEV 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 1/3 (33%)
PTKc_Csk_like 793..1047 CDD:270635 83/277 (30%)
STYKc 800..1044 CDD:214568 83/270 (31%)
NIK1NP_197104.1 LRRNT_2 39..78 CDD:285463
leucine-rich repeat 107..130 CDD:275380
LRR_8 129..189 CDD:290566
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
PKc_like 318..586 CDD:304357 83/264 (31%)
TyrKc 318..583 CDD:197581 83/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.