DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and CRK13

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001078435.1 Gene:CRK13 / 828420 AraportID:AT4G23210 Length:673 Species:Arabidopsis thaliana


Alignment Length:236 Identity:76/236 - (32%)
Similarity:114/236 - (48%) Gaps:24/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 IPEAELQLRESIGKGEFGDVMLGILRNEK-VAVKML--KDEGAVQKFLAEASVMTTLEHDNLVKF 856
            |..|.....|.:|.|..|.|..|.|.:.| :|||.|  |.|.:.::|..|..::..|:|.|||:.
plant   353 IETATNNFSERLGHGGSGHVFKGRLPDGKEIAVKRLSEKTEQSKKEFKNEVVLVAKLQHRNLVRL 417

  Fly   857 IGLVFTSKHLYLVTEYMSKGSLVDYL----RSRGRQHITKKDQIIFAYDTASGMEYLEAKK---V 914
            :|.....:...:|.||:...|| ||:    ..:|.....|:.:||..  ||.|:.||....   :
plant   418 LGFSVKGEEKIIVYEYLPNRSL-DYILFDPTKQGELDWKKRYKIIGG--TARGILYLHQDSQPTI 479

  Fly   915 VHRDLAARNVLISEDCVAKVSDFGLAREECYNLD--------VGKLPIKWTAPEALKNGRFSNKS 971
            :||||.|.|:|:......||:|||.||  .:.:|        ....| .:.|||.::.|.||.||
plant   480 IHRDLKAGNILLDAHMNPKVADFGTAR--IFGMDQSVAITANAAGTP-GYMAPEYMELGEFSMKS 541

  Fly   972 DMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAP 1012
            |::|:|:|:.||....|......|:.:.|.:|...:|...|
plant   542 DVYSYGVLVLEIICGKRNTSFSSPVQNFVTYVWRLWKSGTP 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 76/236 (32%)
STYKc 800..1044 CDD:214568 74/231 (32%)
CRK13NP_001078435.1 Stress-antifung 26..124 CDD:396296
Stress-antifung <175..245 CDD:396296
STKc_IRAK 364..628 CDD:270968 73/225 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.