DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and CERK1

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_566689.2 Gene:CERK1 / 821717 AraportID:AT3G21630 Length:617 Species:Arabidopsis thaliana


Alignment Length:325 Identity:97/325 - (29%)
Similarity:141/325 - (43%) Gaps:93/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 VDKGWVIPEAELQLRE------------SIGKGEFGDVMLGILRNEKVAVKMLKDEGAVQKFLAE 841
            |||     ..|..|.|            .||:|.||.|....||.||.|:|.: |..|.::||||
plant   304 VDK-----SVEFSLEELAKATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKM-DMEASKQFLAE 362

  Fly   842 ASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHI--TKKDQIIFAYDTAS 904
            ..|:|.:.|.|||:.||...... |:||.||:..|:|..:|...||:.:  ||:.||  |.|:|.
plant   363 LKVLTRVHHVNLVRLIGYCVEGS-LFLVYEYVENGNLGQHLHGSGREPLPWTKRVQI--ALDSAR 424

  Fly   905 GMEYLEAKKV---VHRDLAARNVLISEDCVAKVSDFGLAREECYNLDVGKLPIK-------WTAP 959
            |:||:....|   ||||:.:.|:||.:...|||:||||.:    ..:||....:       :.||
plant   425 GLEYIHEHTVPVYVHRDIKSANILIDQKFRAKVADFGLTK----LTEVGGSATRGAMGTFGYMAP 485

  Fly   960 EALKNGRFSNKSDMWSFGILLWEIYS----------------------------------FGRVP 990
            |.: .|..|.|.|:::||::|:|:.|                                  ..::.
plant   486 ETV-YGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEESFKETDKEEALRKII 549

  Fly   991 YPRI----PLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAELKVKLQLLNNAT 1051
            .||:    |...|.|..|:|      :.|..|           |...||:...:.|.|..|.::|
plant   550 DPRLGDSYPFDSVYKMAELG------KACTQE-----------NAQLRPSMRYIVVALSTLFSST 597

  Fly  1052  1051
            plant   598  597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 92/315 (29%)
STYKc 800..1044 CDD:214568 90/305 (30%)
CERK1NP_566689.2 mltD <104..202 CDD:182727
PKc_like 328..587 CDD:419665 87/284 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1899
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.