DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and ARSK1

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_180197.1 Gene:ARSK1 / 817169 AraportID:AT2G26290 Length:424 Species:Arabidopsis thaliana


Alignment Length:272 Identity:79/272 - (29%)
Similarity:128/272 - (47%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   806 IGKGEFGDVMLGILRN--------EKVAVKMLKDEG--AVQKFLAEASVMTTLEHDNLVKFIGLV 860
            :|:|.||.|..|.:.:        :.||||.|...|  ..:::|||...:..|.:.:|||.||..
plant    94 LGEGGFGPVYKGFIDDKVKPGIEAQPVAVKALDLHGHQGHREWLAEILFLGQLSNKHLVKLIGFC 158

  Fly   861 FTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYL-EAKK-VVHRDLAARN 923
            ...:...||.|||.:|||.:.|..|....:....::..|...|.|:.:| ||:| |::||....|
plant   159 CEEEQRVLVYEYMPRGSLENQLFRRNSLAMAWGIRMKIALGAAKGLAFLHEAEKPVIYRDFKTSN 223

  Fly   924 VLISEDCVAKVSDFGLARE----ECYNLDVGKLPIK-WTAPEALKNGRFSNKSDMWSFGILLWEI 983
            :|:..|..||:||||||::    |..::....:..: :.|||.:..|..:..:|::|||::|.|:
plant   224 ILLDSDYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLEL 288

  Fly   984 YSFGR-------------VPYPRIPLADVVKHVEV-------GYKMEAPEGCPPEIYEMMRQAWD 1028
            .:..|             |.:.|..|.|..|...:       .:|.||.:......|:.:.|   
plant   289 ITGKRSMDNTRTRREQSLVEWARPMLRDQRKLERIIDPRLANQHKTEAAQVAASLAYKCLSQ--- 350

  Fly  1029 LNPAKRPTFAEL 1040
             :|..|||..|:
plant   351 -HPKYRPTMCEV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 79/272 (29%)
STYKc 800..1044 CDD:214568 79/272 (29%)
ARSK1NP_180197.1 STYKc 93..365 CDD:214568 79/272 (29%)
PKc_like 94..368 CDD:304357 79/272 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.