DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and Lyn

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_110484.1 Gene:Lyn / 81515 RGDID:621017 Length:512 Species:Rattus norvegicus


Alignment Length:430 Identity:159/430 - (36%)
Similarity:235/430 - (54%) Gaps:51/430 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 WSSGSTTAMNHASLSPTALAPQQGRSRCEVKLNAM---PWFHGSITRDEAE-HLLQP-REDGLFL 707
            |.:.|.::.....:....:|          |:|.:   .||...|||.:|| .||.| ...|.||
  Rat   100 WKAKSLSSKREGFIPSNYVA----------KVNTLETEEWFFKDITRKDAERQLLAPGNSAGAFL 154

  Fly   708 VRESTNFPGDYTLCV-----CFQSKVEHYRVKYLEN-------KLTIDDEEYFENLGQLVAHYEA 760
            :|||....|.::|.|     .....::||:::.|:|       ::|      |..:..::.||:.
  Rat   155 IRESETLKGSFSLSVRDYDPMHGDVIKHYKIRSLDNGGYYISPRIT------FPCISDMIKHYQK 213

  Fly   761 DADGLCTQLIKCLPKLGKQEFCIN---SKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNE 822
            .:||||.:|.|.         ||:   .|.:....|.||...::|.:.:|.|:||:|.:|...|.
  Rat   214 QSDGLCRRLEKA---------CISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGYYNNS 269

  Fly   823 -KVAVKMLK-DEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSR 885
             |||||.|| ...:.|.||.||::|.||:||.||:...:|...:.:|::||:|:||||:|:|:|.
  Rat   270 TKVAVKTLKPGTMSAQAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSD 334

  Fly   886 GRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAR---EECYNL 947
            ....:.....|.|:...|.||.|:|.|..:||||.|.|||:||..:.|::||||||   :..|..
  Rat   335 EGSKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTA 399

  Fly   948 DVG-KLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEA 1011
            ..| |.|||||||||:..|.|:.|||:|||||||:||.::|::|||....|||:..:..||:|..
  Rat   400 REGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPR 464

  Fly  1012 PEGCPPEIYEMMRQAWDLNPAKRPTFAELKVKLQLLNNAT 1051
            .|.||.|:|::|:..|..:..:||||..|:..|.....||
  Rat   465 MENCPDELYDIMKMCWKESAEERPTFDYLQSVLDDFYTAT 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 34/113 (30%)
PTKc_Csk_like 793..1047 CDD:270635 116/259 (45%)
STYKc 800..1044 CDD:214568 112/249 (45%)
LynNP_110484.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
SH3_Lyn 67..122 CDD:212937 4/31 (13%)
SH2_Src_Lyn 125..225 CDD:198227 32/105 (30%)
PTKc_Lyn 239..510 CDD:270657 118/266 (44%)
Pkinase_Tyr 247..497 CDD:285015 112/249 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D248674at33208
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.