DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and TXK

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_024309968.1 Gene:TXK / 7294 HGNCID:12434 Length:530 Species:Homo sapiens


Alignment Length:388 Identity:142/388 - (36%)
Similarity:223/388 - (57%) Gaps:42/388 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 LNAMPWFHGSITRDEAEHLL-QPREDGLFLVRESTNFPGDYTLCVCF------QSKVEHYRVKYL 736
            |....|:|.:|||::||||| |..::|.|:||:|.:. |.||:.|..      ::.::||::|..
Human   148 LEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHL-GSYTISVFMGARRSTEAAIKHYQIKKN 211

  Fly   737 EN-KLTIDDEEYFENLGQLVAHYEADADGLCTQLI-------KCLPKLGKQEFCINSKDFVDKGW 793
            :: :..:.:...|:::.:|:.:::.:|.||.|:|.       .|||.         :..|..:.|
Human   212 DSGQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSCLPA---------TAGFSYEKW 267

  Fly   794 VIPEAELQLRESIGKGEFGDVMLGILRNE-KVAVKMLKDEGAV--QKFLAEASVMTTLEHDNLVK 855
            .|..:||...:.||.|:||.|.||..|:. :||:|.: :||::  :.|:.||.||..|.|..||:
Human   268 EIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAI-NEGSMSEEDFIEEAKVMMKLSHSKLVQ 331

  Fly   856 FIGLVFTSKHLYLVTEYMSKGSLVDYLR-SRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDL 919
            ..|:....|.||:|||:|..|.|::||| ::|:  :.|:..:....|...||||||....:||||
Human   332 LYGVCIQRKPLYIVTEFMENGCLLNYLRENKGK--LRKEMLLSVCQDICEGMEYLERNGYIHRDL 394

  Fly   920 AARNVLISEDCVAKVSDFGLAREECYNLD-------VGKLPIKWTAPEALKNGRFSNKSDMWSFG 977
            ||||.|:|..|:.|:||||:.|   |.||       ..|.||||:.||.....::|:|||:||||
Human   395 AARNCLVSSTCIVKISDFGMTR---YVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFG 456

  Fly   978 ILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 1040
            :|:||:::.|::|:.......||:.:..|:::..|...|..|||:|...|...|..|||||||
Human   457 VLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAEL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 33/111 (30%)
PTKc_Csk_like 793..1047 CDD:270635 107/259 (41%)
STYKc 800..1044 CDD:214568 104/252 (41%)
TXKXP_024309968.1 SH3_TXK 88..142 CDD:212840
SH2_Tec_Txk 146..251 CDD:198261 31/103 (30%)
PTKc_Tec_like 269..524 CDD:173637 106/257 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.