DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and PTK6

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_005966.1 Gene:PTK6 / 5753 HGNCID:9617 Length:451 Species:Homo sapiens


Alignment Length:371 Identity:132/371 - (35%)
Similarity:202/371 - (54%) Gaps:15/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PWFHGSITRDEAEHLLQPRED--GLFLVRESTNFPGDYTLCVCFQSKVEHYRV-KYLENKLTIDD 744
            |||.|.|:|.||...||...:  |.||:|.|.....||.|.|.....|.||:: :....:|.:::
Human    77 PWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNE 141

  Fly   745 EEYFENLGQLVAHYEADADGLCTQLIKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKG 809
            ...|.:|.:||.::.|.:  |...|....|....:...:...|    .|..|..|..|...:|.|
Human   142 AVSFLSLPELVNYHRAQS--LSHGLRLAAPCRKHEPEPLPHWD----DWERPREEFTLCRKLGSG 200

  Fly   810 EFGDVMLGILRNE-KVAVKMLKDEGAV--QKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTE 871
            .||:|..|:.::. :||:|::..:..:  |...:|...|..|.|.:::....:|.....:|::||
Human   201 YFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVYIITE 265

  Fly   872 YMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSD 936
            .|:||||::.||....:.:...:.:..|:..|.||.|||::..:||||||||:|:.|:.:.||.|
Human   266 LMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGD 330

  Fly   937 FGLAR---EECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLAD 998
            |||||   |:.|......:|.||||||||..|.:|.|||:|||||||.|::|.|:||||.:...:
Human   331 FGLARLIKEDVYLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHE 395

  Fly   999 VVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAELKVKL 1044
            ....|:.||:|..|..|||.::::|...|..:|.:||.|..|:.:|
Human   396 AFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 31/96 (32%)
PTKc_Csk_like 793..1047 CDD:270635 100/258 (39%)
STYKc 800..1044 CDD:214568 96/249 (39%)
PTK6NP_005966.1 SH3_Brk 12..69 CDD:212781
SH2_PTK6_Brk 75..174 CDD:198221 31/98 (32%)
Linker 171..190 3/22 (14%)
PTKc_Srm_Brk 184..444 CDD:133248 100/258 (39%)
STYKc 192..441 CDD:214568 96/248 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D248674at33208
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.