DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and NCK1

DIOPT Version :10

Sequence 1:NP_731611.2 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_006144.1 Gene:NCK1 / 4690 HGNCID:7664 Length:377 Species:Homo sapiens


Alignment Length:115 Identity:34/115 - (29%)
Similarity:57/115 - (49%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   653 TTAMNHASLSPTALAPQQGRSRCEV-------KLNAMPWFHGSITRDEAEHLLQPR-EDGLFLVR 709
            |...|:...|....:|.|    |:.       |....||::|.:||.:||..|..| .:|.||:|
Human   248 TVMQNNPLTSGLEPSPPQ----CDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIR 308

  Fly   710 ESTNFPGDYTLCVCFQSKVEHYRVKYLENKLTIDDEEYFENLGQLVAHYE 759
            :|.:.|.|:::.:..|.|.:|::|:..|....|...: |..:.:||.||:
Human   309 DSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRK-FSTMEELVEHYK 357

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CskNP_731611.2 SH2_csk_like 680..777 CDD:198190 27/81 (33%)
PTKc_Csk_like 793..1047 CDD:270635
NCK1NP_006144.1 SH3_Nck1_1 3..61 CDD:212833
SH3_Nck1_2 108..162 CDD:212834