DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and Ack

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_647859.1 Gene:Ack / 38489 FlyBaseID:FBgn0028484 Length:1073 Species:Drosophila melanogaster


Alignment Length:426 Identity:128/426 - (30%)
Similarity:196/426 - (46%) Gaps:84/426 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 STTAMNHASLSPTALAPQQGRSRCEVKLNAMPWFHGSITRDEAEHLLQPREDGLFLVRESTNF-- 714
            ||:|::....|.||                  |....:...:.|..|....|.|.:.| ..:|  
  Fly     3 STSAVDGGLGSETA------------------WLEDLLREVQLEQFLDRIRDDLQVTR-LAHFDY 48

  Fly   715 --PGDYTLC-----------VCFQSKVEHYRVKYLENKLTIDDEEYFENLGQLVAHYEADADGLC 766
              |.|...|           ...:.|..|...|.:.:||....::.........|...:..:|  
  Fly    49 VLPDDLERCGLGKPAIRRLMEAVRKKKAHQWRKNILSKLIGGGKQPSSKKQSSAARESSQGNG-- 111

  Fly   767 TQLIKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLG---------ILRNE 822
            ||| .||                     |.|.::.:...:|.|.||.|..|         ::   
  Fly   112 TQL-TCL---------------------IHEKDITMGLKLGDGSFGVVRRGEWSASPAGKVI--- 151

  Fly   823 KVAVKMLKDE-----GAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYL 882
            .||||:||.:     |.:..|..|...|..|:|.|||:..|:|. |:.:.::||...:|||:|.|
  Fly   152 PVAVKVLKSDNLTQPGIIDDFFREVQAMHALDHANLVRLYGVVL-SQPMMMITELAERGSLLDTL 215

  Fly   883 RSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAR-----E 942
            |.:.| |.:......::....:||.|||.|:.:|||||.||||::.....|:.||||.|     :
  Fly   216 RKQCR-HTSLTIIWNWSVQIVTGMAYLEQKRFLHRDLACRNVLLAAGNKIKIGDFGLMRALPQED 279

  Fly   943 ECYNL-DVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVE-V 1005
            :||.: :..|:|..|.|||:|:..:||:.||.|.||:.|||::|||..|:..:..:.:::.:: .
  Fly   280 DCYVMSEHKKVPFPWCAPESLRFRQFSHASDTWMFGVTLWEMFSFGEDPWVGLNGSQILRKIDRE 344

  Fly  1006 GYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAELK 1041
            |.::..|:.|||::|.||.|.||..||:|||||.||
  Fly   345 GERLHQPDACPPDVYAMMLQCWDKTPAERPTFAALK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 22/111 (20%)
PTKc_Csk_like 793..1047 CDD:270635 100/270 (37%)
STYKc 800..1044 CDD:214568 98/263 (37%)
AckNP_647859.1 SAM_TNK-like 14..75 CDD:188938 12/79 (15%)
PTKc_Ack_like 128..385 CDD:270636 98/258 (38%)
UBA_TNK1 1031..1070 CDD:270513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468354
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.