DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and Ptk6

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_033210.1 Gene:Ptk6 / 20459 MGIID:99683 Length:451 Species:Mus musculus


Alignment Length:372 Identity:140/372 - (37%)
Similarity:205/372 - (55%) Gaps:17/372 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PWFHGSITRDEAEHLLQPRED--GLFLVRESTNFPGDYTLCVCFQSKVEHYRV-KYLENKLTIDD 744
            |||.|.|:|.||.|.||..::  |.||:|.|.....||.|.|.....|.|||: |..|.:|.:::
Mouse    77 PWFFGCISRSEAMHRLQAEDNSKGAFLIRVSQKPGADYVLSVRDAQAVRHYRIWKNNEGRLHLNE 141

  Fly   745 EEYFENLGQLVAHYEADADGLCTQL-IKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGK 808
            ...|.||.:||.:::..:.....|| :.|...  |.|...:..|     |..|..|..|.:.:|.
Mouse   142 AVSFSNLSELVDYHKTQSLSHGLQLSMPCWKH--KTEPLPHWDD-----WERPREEFTLCKKLGA 199

  Fly   809 GEFGDVMLGILRNE-KVAVKMLKDEGAVQK--FLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVT 870
            |.||:|...:.:.: .||||::..:..:.:  |.||...|..|.|.:::....:......:|::|
Mouse   200 GYFGEVFEALWKGQVHVAVKVISRDNLLHQHTFQAEIQAMKKLRHKHILSLYAVATAGDPVYIIT 264

  Fly   871 EYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVS 935
            |.|.||:|:..||....:.:...:.:.||...|.||.|||::..:||||||||||::|:.:.||.
Mouse   265 ELMPKGNLLQLLRDSDEKALPILELVDFASQVAEGMCYLESQNYIHRDLAARNVLVTENNLCKVG 329

  Fly   936 DFGLAR---EECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLA 997
            ||||||   |:.|......:|.||||||||..|.:|.|||:||||:||.||:|.|::|||.:...
Mouse   330 DFGLARLVKEDIYLSHEHNVPYKWTAPEALSRGHYSIKSDVWSFGVLLHEIFSRGQMPYPGMSNH 394

  Fly   998 DVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAELKVKL 1044
            :....|:.||:|..|..|||.|:::|...|..:|.:||.|.:|..||
Mouse   395 ETFLRVDAGYRMPCPLECPPNIHKLMLSCWSRDPKQRPCFKDLCEKL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 35/97 (36%)
PTKc_Csk_like 793..1047 CDD:270635 102/258 (40%)
STYKc 800..1044 CDD:214568 97/249 (39%)
Ptk6NP_033210.1 SH3 12..69 CDD:302595
SH2_PTK6_Brk 75..174 CDD:198221 35/98 (36%)
Linker 171..190 5/25 (20%)
PKc_like 184..444 CDD:304357 102/258 (40%)
STYKc 192..441 CDD:214568 97/248 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D248674at33208
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.