DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and Jak1

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_666257.2 Gene:Jak1 / 16451 MGIID:96628 Length:1153 Species:Mus musculus


Alignment Length:427 Identity:112/427 - (26%)
Similarity:189/427 - (44%) Gaps:88/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   672 RSRCEVKLNAMPWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKYL 736
            |..|   :..:||.......|         ...|.:..:..:| |.....:|:..::.      |
Mouse   748 RQEC---IERIPWIAPECVED---------SKNLSVAADKWSF-GTTLWEICYNGEIP------L 793

  Fly   737 ENKLTIDDEEYFEN-----------LGQLVA---HYEADADGLCTQLIKCLPKLGKQEFCINSKD 787
            ::|..|:.|.::|:           |..|:.   :|:.:.......:::.:.||.:|     :.|
Mouse   794 KDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQ-----NPD 853

  Fly   788 FVDKGWVIPEAE--------LQLRESIGKGEFGDVML------GILRNEKVAVKMLKDEGA---V 835
            .|.:.....|.:        |:....:|:|.||.|.|      |....|:||||.||.|..   :
Mouse   854 IVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHI 918

  Fly   836 QKFLAEASVMTTLEHDNLVKFIGLVFT--SKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIF 898
            .....|..::..|.|:|:||:.|:...  ...:.|:.|::..|||.:|| .:.:..|..|.|:.:
Mouse   919 ADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYL-PKNKNKINLKQQLKY 982

  Fly   899 AYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAR-----EECYNL-DVGKLPIKWT 957
            |.....||:||.:::.|||||||||||:..:...|:.||||.:     :|.|.: |....|:.|.
Mouse   983 AIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWY 1047

  Fly   958 APEALKNGRFSNKSDMWSFGILLWEIYSF-------------------GRVPYPRIPLADVVKHV 1003
            |||.|...:|...||:||||:.|.|:.::                   |::...|:     |..:
Mouse  1048 APECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRL-----VNTL 1107

  Fly  1004 EVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 1040
            :.|.::..|..||.|:|::||:.|:..|:.|.||..|
Mouse  1108 KEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNL 1144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 16/110 (15%)
PTKc_Csk_like 793..1047 CDD:270635 90/292 (31%)
STYKc 800..1044 CDD:214568 89/277 (32%)
Jak1NP_666257.2 FERM_F1 <52..129 CDD:408179
FERM_F2 147..277 CDD:408177
FERM_C_JAK1 282..426 CDD:275412
SH2_Jak1 426..526 CDD:198241
PTK_Jak1_rpt1 582..845 CDD:270662 17/115 (15%)
PTKc_Jak1_rpt2 869..1152 CDD:173644 89/282 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.