DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and Fgfr1

DIOPT Version :10

Sequence 1:NP_731611.2 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_034336.2 Gene:Fgfr1 / 14182 MGIID:95522 Length:822 Species:Mus musculus


Alignment Length:285 Identity:114/285 - (40%)
Similarity:177/285 - (62%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   790 DKGWVIPEAELQLRESIGKGEFGDVML----GILRNE-----KVAVKMLKDEGAVQK----FLAE 841
            |..|.:|...|.|.:.:|:|.||.|:|    |:.:::     ||||||||.: |.:|    .::|
Mouse   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSD-ATEKDLSDLISE 531

  Fly   842 ASVMTTL-EHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSR--------------GRQHIT 891
            ..:|..: :|.|::..:|.......||::.||.|||:|.:||::|              ..:.::
Mouse   532 MEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLS 596

  Fly   892 KKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAREECYNLDV------G 950
            .||.:..||..|.|||||.:||.:||||||||||::||.|.|::|||||| :.:::|.      |
Mouse   597 SKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLAR-DIHHIDYYKKTTNG 660

  Fly   951 KLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGC 1015
            :||:||.|||||.:..::::||:||||:|||||::.|..|||.:|:.::.|.::.|::|:.|..|
Mouse   661 RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNC 725

  Fly  1016 PPEIYEMMRQAWDLNPAKRPTFAEL 1040
            ..|:|.|||..|...|::||||.:|
Mouse   726 TNELYMMMRDCWHAVPSQRPTFKQL 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_731611.2 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 113/282 (40%)
Fgfr1NP_034336.2 IgI_1_FGFR 25..118 CDD:409362
Ig strand A 25..28 CDD:409362
Ig strand A' 40..46 CDD:409362
Ig strand B 49..59 CDD:409362
Ig strand C 63..68 CDD:409362
Ig strand C' 71..73 CDD:409362
Ig strand D 78..82 CDD:409362
Ig strand E 85..90 CDD:409362
Ig strand F 96..105 CDD:409362
Ig strand G 108..118 CDD:409362
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..162
IgI_2_FGFR 153..247 CDD:409443
Ig strand A 153..156 CDD:409443
Heparin-binding 160..177
Ig strand A' 164..169 CDD:409443
Ig strand B 173..181 CDD:409443
Ig strand C 187..192 CDD:409443
Ig strand C' 195..197 CDD:409443
Ig strand D 206..209 CDD:409443
Ig strand E 213..218 CDD:409443
Ig strand F 227..234 CDD:409443
Ig strand G 237..247 CDD:409443
Ig 255..359 CDD:472250
Ig strand B 273..277 CDD:409353
Ig strand C 286..290 CDD:409353
Ig strand E 324..328 CDD:409353
Ig strand F 338..343 CDD:409353
Ig strand G 351..354 CDD:409353
PTKc_FGFR1 464..765 CDD:270678 114/285 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 782..822
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.