DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and Crk

DIOPT Version :10

Sequence 1:NP_731611.2 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_061518001.1 Gene:Crk / 1271411 VectorBaseID:AGAMI1_013646 Length:279 Species:Anopheles gambiae


Alignment Length:111 Identity:41/111 - (36%)
Similarity:61/111 - (54%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   684 WFHGSITRDEA-EHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKYLENKLTIDDE-- 745
            |:.|:::|.:| :.||..||.|:||||:||...||:.|||...|||.||.:    |||...||  
Mosquito    12 WYFGAMSRQDATDLLLNERESGVFLVRDSTTIVGDFVLCVREDSKVSHYII----NKLPSGDECF 72

  Fly   746 ------EYFENLGQLVAHYE---ADADGLCTQLIKCLPK-LGKQEF 781
                  :.|.:|..|::.|:   .|...|...:::.|.| :||.:|
Mosquito    73 VYRIGDQTFADLPDLLSFYKLHYLDTTPLRRPMVRRLEKVIGKFDF 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_731611.2 SH2_csk_like 680..777 CDD:198190 38/105 (36%)
PTKc_Csk_like 793..1047 CDD:270635
CrkXP_061518001.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.