DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and Bmx

DIOPT Version :9

Sequence 1:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_033889.2 Gene:Bmx / 12169 MGIID:1101778 Length:655 Species:Mus musculus


Alignment Length:404 Identity:147/404 - (36%)
Similarity:232/404 - (57%) Gaps:27/404 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   657 NHASLSPTALA---PQQGRSRCEVKLNAMPWFHGSITRDEAEHLL-QPREDGLFLVRESTNFPGD 717
            |.||.|.:.::   |:...|..|..|:|..||.|:|:|.::|.|| |..::|.|:||.|:.. |.
Mouse   246 NIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQM-GM 309

  Fly   718 YTLCVCFQS------KVEHYRV-KYLENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCL-P 774
            ||:.:..::      .|:||.| ...||||.:.:...|:::.:|:.:::.::.|:.|:|...: .
Mouse   310 YTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVST 374

  Fly   775 KLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNE-KVAVKMLKDEGAV--Q 836
            |..|....:.....:   |.:...|:.|.:.:|.|:||.|.||..:.: .|||||:| |||:  .
Mouse   375 KANKVPVSVALGSGI---WELKREEITLLKELGNGQFGVVQLGQWKGQYDVAVKMIK-EGAMSED 435

  Fly   837 KFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQII-FAY 900
            :|..||..|..|.|..||||.|:......:|:||||::.|.|::||:|.|:.  .:..|:: ..|
Mouse   436 EFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNYLKSHGKG--LESCQLLEMCY 498

  Fly   901 DTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAR---EECYNLDVG-KLPIKWTAPEA 961
            |...||.:||:.:.:||||||||.|:..|...||||||:.|   ::.|...|| |.|:||:|||.
Mouse   499 DVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEV 563

  Fly   962 LKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQA 1026
            ....::|:|||:|:||||:||::|.|:.||.....::||..|..|:::..|:.....||::|...
Mouse   564 FHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSEVVVKVSQGHRLYRPQLASDTIYQIMYSC 628

  Fly  1027 WDLNPAKRPTFAEL 1040
            |...|.|||||.:|
Mouse   629 WHELPEKRPTFQQL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190 32/105 (30%)
PTKc_Csk_like 793..1047 CDD:270635 106/256 (41%)
STYKc 800..1044 CDD:214568 104/249 (42%)
BmxNP_033889.2 PH_Btk 25..151 CDD:269944
PH 27..115 CDD:278594
SH2_Tec_Bmx 269..374 CDD:198262 32/105 (30%)
PKc_like 392..647 CDD:304357 105/254 (41%)
Pkinase_Tyr 397..646 CDD:285015 104/249 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.