DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csk and LOC100496572

DIOPT Version :10

Sequence 1:NP_731611.2 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001415012.1 Gene:LOC100496572 / 100496572 XenbaseID:XB-GENE-29083231 Length:1368 Species:Xenopus tropicalis


Alignment Length:46 Identity:9/46 - (19%)
Similarity:15/46 - (32%) Gaps:11/46 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YKTVWHSSALDDSAGKVKYTVPFTTDLANIIPKLKFDMFYSFKYCH 181
            :|::.||..:...|..:...:|...           ...|.||..|
 Frog   114 FKSITHSFKVQTLARSLGLQMPVVV-----------QSMYIFKQPH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CskNP_731611.2 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635
LOC100496572NP_001415012.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.