Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001156863.1 | Gene: | ZSCAN12 / 9753 | HGNCID: | 13172 | Length: | 611 | Species: | Homo sapiens |
Alignment Length: | 237 | Identity: | 71/237 - (29%) |
---|---|---|---|
Similarity: | 106/237 - (44%) | Gaps: | 24/237 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 CTTCLDNLQAAIKFRQRCIIAEKQNL----ERIECDSKDCSTDPIIYEDIDDNQIESELDESILC 109
Fly 110 PEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVF 174
Fly 175 LNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVS 239
Fly 240 SGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHK 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | 7/30 (23%) |
C2H2 Zn finger | 144..164 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 14/24 (58%) | ||
UFD2 | <256..>294 | CDD:227443 | 10/26 (38%) | ||
C2H2 Zn finger | 258..280 | CDD:275368 | 7/21 (33%) | ||
ZSCAN12 | NP_001156863.1 | SCAN | 42..152 | CDD:128708 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 154..175 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 198..264 | ||||
C2H2 Zn finger | 248..268 | CDD:275368 | |||
C2H2 Zn finger | 276..296 | CDD:275368 | |||
COG5048 | 299..579 | CDD:227381 | 61/208 (29%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 332..352 | CDD:275368 | |||
C2H2 Zn finger | 360..380 | CDD:275368 | |||
C2H2 Zn finger | 388..408 | CDD:275368 | 7/25 (28%) | ||
C2H2 Zn finger | 416..436 | CDD:275368 | 4/24 (17%) | ||
C2H2 Zn finger | 444..463 | CDD:275368 | 4/23 (17%) | ||
C2H2 Zn finger | 471..491 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 499..519 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 527..547 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 555..575 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 583..603 | CDD:275368 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |