DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF566

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001138815.1 Gene:ZNF566 / 84924 HGNCID:25919 Length:419 Species:Homo sapiens


Alignment Length:154 Identity:57/154 - (37%)
Similarity:81/154 - (52%) Gaps:4/154 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 TSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHT 191
            :.|.....|..|..||.|.:||:..::.|||..|...|||.|.:.|  ..|.::|::....|.|.
Human   241 SDLTRHHRIHTGEKPYECKECGKAFSSGSNFTRHQRIHTGEKPYEC--KECGKAFSSGSNFTQHQ 303

  Fly   192 RIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNH 256
            ||||||:||.|..|...||.|....:|.|.|..|:.|||..|:|:|.|...|.:|:.||...:.:
Human   304 RIHTGEKPYECKECGNAFSQSSQLIKHQRIHTGEKPYECKECEKAFRSGSDLTRHQRIHTGEKPY 368

  Fly   257 YCYVCQKHFKRISHLMTHLSSNIH 280
            .|.:|.|.:.:.|.|::|  ..||
Human   369 ECKICGKAYSQSSQLISH--HRIH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 8/25 (32%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
ZNF566NP_001138815.1 KRAB 6..66 CDD:214630
KRAB 6..45 CDD:279668
COG5048 <154..330 CDD:227381 34/90 (38%)
zf-C2H2 200..222 CDD:278523
C2H2 Zn finger 202..222 CDD:275368
zf-H2C2_2 215..237 CDD:290200
C2H2 Zn finger 230..250 CDD:275368 1/8 (13%)
zf-H2C2_2 242..267 CDD:290200 8/24 (33%)
COG5048 <254..405 CDD:227381 54/141 (38%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
zf-H2C2_2 270..295 CDD:290200 10/26 (38%)
C2H2 Zn finger 286..306 CDD:275368 6/21 (29%)
zf-H2C2_2 298..323 CDD:290200 13/24 (54%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
zf-H2C2_2 327..351 CDD:290200 10/23 (43%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
zf-H2C2_2 354..379 CDD:290200 7/24 (29%)
C2H2 Zn finger 370..390 CDD:275368 6/21 (29%)
C2H2 Zn finger 398..417 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.