DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and WIP3

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:237 Identity:47/237 - (19%)
Similarity:75/237 - (31%) Gaps:80/237 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DSKDCSTD----PIIYEDIDDNQI------ESELDESILCPEV----KDLPMPSAEKVSAPTSLN 130
            |..|.:.|    ||..|.|:|..:      :.:.||.|:..:|    |...:||..::.      
plant   116 DGSDITFDHQKKPIKREIIEDGVVMMKKRRKMKFDEEIIDSDVEVCGKRFWIPSPAQIH------ 174

  Fly   131 HQKSIGGGTGP--YVCPDCGRIINNKSNFQEH-----------------TLRHTGIKNF--HCVF 174
                    .||  :.|..|.:..|..:|.|.|                 |::...|...  :|..
plant   175 --------VGPMQFACSICSKTFNRYNNMQMHMWGHGSEFRKGADSLKGTIQPAAILRLPCYCCA 231

  Fly   175 LNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVS 239
            ..|:.:.       :|.|             .:........|.|::|....:.:.|..|.|:...
plant   232 EGCKNNI-------NHPR-------------SKPLKDFRTLQTHYKRKHGSKPFSCGKCGKALAV 276

  Fly   240 SGCLRKHKMIHVDARN----HYCYVCQKHFKRISHLMTHLSS 277
            .|..|.|:      :|    .|| .|...||....|..|:.|
plant   277 KGDWRTHE------KNCGKLWYC-TCGSDFKHKRSLKDHIRS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/36 (19%)
C2H2 Zn finger 172..194 CDD:275368 4/21 (19%)
zf-H2C2_2 186..211 CDD:290200 2/24 (8%)
UFD2 <256..>294 CDD:227443 8/22 (36%)
C2H2 Zn finger 258..280 CDD:275368 7/20 (35%)
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.