DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF669

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_079080.2 Gene:ZNF669 / 79862 HGNCID:25736 Length:464 Species:Homo sapiens


Alignment Length:372 Identity:91/372 - (24%)
Similarity:132/372 - (35%) Gaps:98/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RILNCRICS--RSDAPIDLF--GPGN-GHLVRQIHSITGVELSCKKEISGQMCTTCLDNL----- 56
            |:.|.|..|  ||...: ||  |||. |.....:|.:    .:|.:..  :....|.:.|     
Human    30 RLRNLRTESPWRSRGSV-LFCSGPGRAGRAAEPLHPV----CTCGRHF--RRPEPCREPLASPIQ 87

  Fly    57 ------QAAIKFRQR---CIIAEKQNLERIECDSKDCSTDPIIYEDIDDNQIESELDE------- 105
                  ..|:.|.|.   .:.:.::||.| |...:.|.....:.....|..||...::       
Human    88 DSVAFEDVAVNFTQEEWALLDSSQKNLYR-EVMQETCRNLASVGSQWKDQNIEDHFEKPGKDIRN 151

  Fly   106 ---SILCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGI 167
               ..||...:|  ....|.||...:|:..::|..|..|..|..||::....|....|.|.|:|.
Human   152 HIVQRLCESKED--GQYGEVVSQIPNLDLNENISTGLKPCECSICGKVFVRHSLLNRHILAHSGY 214

  Fly   168 KNF----------------------HCV------------------FLN---------------- 176
            |.:                      |.:                  |||                
Human   215 KPYGEKQYKCEQCGKFFVSVPGVRRHMIMHSGNPAYKCTICGKAFYFLNSVERHQRTHTGEKPYK 279

  Fly   177 ---CERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFV 238
               |.::|........|.|.||||:||.|..|.:.|..|.:.:.|.|.|..||.|:|..|.|:|.
Human   280 CKQCGKAFTVSGSCLIHERTHTGEKPYECKECGKTFRFSCSFKTHERTHTGERPYKCTKCDKAFS 344

  Fly   239 SSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEE 285
            .|..||.|..||...|.:.|..|.|.|.|:|.|..|.|::..::..|
Human   345 CSTSLRYHGSIHTGERPYECKQCGKAFSRLSSLCNHRSTHTGEKPYE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 19/88 (22%)
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 7/58 (12%)
zf-H2C2_2 186..211 CDD:290200 11/24 (46%)
UFD2 <256..>294 CDD:227443 10/30 (33%)
C2H2 Zn finger 258..280 CDD:275368 9/21 (43%)
ZNF669NP_079080.2 KRAB 90..>132 CDD:214630 8/42 (19%)
KRAB 90..129 CDD:279668 8/39 (21%)
C2H2 Zn finger 167..183 CDD:275368 4/15 (27%)
COG5048 <178..436 CDD:227381 57/214 (27%)
C2H2 Zn finger 191..211 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 3/19 (16%)
zf-H2C2_2 264..288 CDD:290200 1/23 (4%)
C2H2 Zn finger 280..300 CDD:275368 4/19 (21%)
zf-H2C2_2 296..315 CDD:290200 10/18 (56%)
C2H2 Zn finger 308..328 CDD:275368 6/19 (32%)
zf-H2C2_2 320..345 CDD:290200 10/24 (42%)
C2H2 Zn finger 336..356 CDD:275368 8/19 (42%)
zf-H2C2_2 348..373 CDD:290200 10/24 (42%)
C2H2 Zn finger 364..384 CDD:275368 9/19 (47%)
zf-H2C2_2 379..401 CDD:290200 3/13 (23%)
C2H2 Zn finger 392..412 CDD:275368 91/372 (24%)
zf-H2C2_2 408..429 CDD:290200
C2H2 Zn finger 420..440 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.