DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF557

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001037852.1 Gene:ZNF557 / 79230 HGNCID:28632 Length:430 Species:Homo sapiens


Alignment Length:188 Identity:61/188 - (32%)
Similarity:84/188 - (44%) Gaps:26/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHC---------------- 172
            |:.:.|...|.|..|..||.|.|||:..:|.|..:.|...|||.|.:.|                
Human   218 SSRSYLTVHKRIHNGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCNQCFREFRTQSIFTRH 282

  Fly   173 ----------VFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERR 227
                      |...|.::|.||..|:||..|||||.||.|..|.|.|.......:|.|.|..|:.
Human   283 KRVHTGEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRTHTGEKP 347

  Fly   228 YECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEE 285
            |.|:.|.|||.:|..|..|:.||...:::.|..|.|.|..:|.:..|:.::..|:..|
Human   348 YTCNECGKSFTNSFSLTIHRRIHNGEKSYECSDCGKSFNVLSSVKKHMRTHTGKKPYE 405

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 9/47 (19%)
zf-H2C2_2 186..211 CDD:290200 14/24 (58%)
UFD2 <256..>294 CDD:227443 8/30 (27%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
ZNF557NP_001037852.1 KRAB 43..100 CDD:214630
KRAB 43..82 CDD:279668
COG5048 <137..422 CDD:227381 61/188 (32%)
C2H2 Zn finger 154..174 CDD:275368
C2H2 Zn finger 182..202 CDD:275368