DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF140

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_011533135.1 Gene:ZNF140 / 7699 HGNCID:12925 Length:458 Species:Homo sapiens


Alignment Length:153 Identity:56/153 - (36%)
Similarity:80/153 - (52%) Gaps:5/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 HQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHT 195
            ||:: ..|..||.|.:||:..:..||..:|.:.|||.|...|  .:|.::|:....|..|.|.||
Human   180 HQRT-HTGEKPYACKECGKTFSQISNLVKHQMIHTGKKPHEC--KDCNKTFSYLSFLIEHQRTHT 241

  Fly   196 GEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYV 260
            ||:||.|..|.:.||.:.....|.|.|..:::|.|..|.|:|.|...|.:|::.|...:.:.|..
Human   242 GEKPYECTECGKAFSRASNLTRHQRIHIGKKQYICRKCGKAFSSGSELIRHQITHTGEKPYECIE 306

  Fly   261 CQKHFKRISHLMTHLSSNIHKRK 283
            |.|.|:|.|||..|.|  ||..|
Human   307 CGKAFRRFSHLTRHQS--IHTTK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 13/28 (46%)
C2H2 Zn finger 258..280 CDD:275368 10/21 (48%)
ZNF140XP_011533135.1 KRAB 6..66 CDD:214630
KRAB 6..45 CDD:279668
COG5048 160..>453 CDD:227381 56/153 (37%)
C2H2 Zn finger 164..184 CDD:275368 2/4 (50%)
zf-H2C2_2 176..201 CDD:290200 8/21 (38%)
C2H2 Zn finger 192..212 CDD:275368 6/19 (32%)
zf-H2C2_2 204..229 CDD:290200 9/26 (35%)
C2H2 Zn finger 220..240 CDD:275368 6/21 (29%)
zf-H2C2_2 233..257 CDD:290200 12/23 (52%)
C2H2 Zn finger 248..268 CDD:275368 6/19 (32%)
zf-H2C2_2 260..285 CDD:290200 8/24 (33%)
C2H2 Zn finger 276..296 CDD:275368 7/19 (37%)
zf-H2C2_2 288..313 CDD:290200 7/24 (29%)
C2H2 Zn finger 304..324 CDD:275368 10/21 (48%)
C2H2 Zn finger 332..352 CDD:275368
C2H2 Zn finger 360..380 CDD:275368
zf-H2C2_2 372..397 CDD:290200
C2H2 Zn finger 388..408 CDD:275368
zf-H2C2_2 400..424 CDD:290200
C2H2 Zn finger 416..436 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.