DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF124

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001284497.1 Gene:ZNF124 / 7678 HGNCID:12907 Length:351 Species:Homo sapiens


Alignment Length:222 Identity:65/222 - (29%)
Similarity:96/222 - (43%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 IYEDI---------------DDNQIESELDES------IL---------CPEV--KDLPMPSAEK 122
            :|.|:               :|..||.:...|      |:         |.|.  |.......:|
Human    37 LYRDVMQETFRNLASIGNKGEDQSIEDQYKNSSRNLRHIISHSGNNPYGCEECGKKPCTCKQCQK 101

  Fly   123 VSAPTSLNHQKSI-GGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKE 186
            .|...:..|:.:: ..|.|.|.|..|.::.|..|:||.|...|||.|.:.|  :.|.::....:.
Human   102 TSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIHQRNHTGEKPYEC--MECGKALGFSRS 164

  Fly   187 LTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHV 251
            |..|.||||||:.|.|..|.:.||.|...::|.|.|..|:.|||..|.|:|..|.||..|:..|.
Human   165 LNRHKRIHTGEKRYECKQCGKAFSRSSHLRDHERTHTGEKPYECKHCGKAFRYSNCLHYHERTHT 229

  Fly   252 DARNHYCYVCQKHFKRISHLMTHLSSN 278
            ..:.:.|..|.|.|..:|.|..|:.::
Human   230 GEKPYVCMECGKAFSCLSSLQGHIKAH 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 5/21 (24%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 7/23 (30%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
ZNF124NP_001284497.1 KRAB 12..53 CDD:307490 2/15 (13%)
C2H2 Zn finger 96..116 CDD:275368 3/19 (16%)
C2H2 Zn finger 124..144 CDD:275368 7/19 (37%)
C2H2 Zn finger 152..172 CDD:275368 5/21 (24%)
COG5048 <176..338 CDD:227381 28/81 (35%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
C2H2 Zn finger 264..284 CDD:275368
C2H2 Zn finger 292..312 CDD:275368
C2H2 Zn finger 320..340 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.