DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF75D

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_009062.2 Gene:ZNF75D / 7626 HGNCID:13145 Length:510 Species:Homo sapiens


Alignment Length:170 Identity:55/170 - (32%)
Similarity:86/170 - (50%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PSAEKVSAPTSLN-HQKSIGGGTG--PYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCER 179
            |:..|...|..:: |.|   |.||  |:.|.:||:.....|:..:|...|||.|.:.|  ..|:|
Human   341 PATCKQELPKLMDLHGK---GPTGEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKC--QQCDR 400

  Fly   180 SFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLR 244
            .|....:|..|...|.|.:||.|.:|.:.||.:.....|.|.|..|:.::||.|.|.|:.:..|.
Human   401 RFRWSSDLNKHFMTHQGIKPYRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLI 465

  Fly   245 KHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKE 284
            ||:..|...:.:.|.:|:::|.|.|.|:.|  ..:|:|:|
Human   466 KHQRTHTGEQPYTCSLCKRNFSRRSSLLRH--QKLHRRRE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 9/24 (38%)
UFD2 <256..>294 CDD:227443 10/29 (34%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
ZNF75DNP_009062.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
SCAN 45..133 CDD:307924
KRAB 234..275 CDD:307490
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..343 1/1 (100%)
zf-C2H2 365..387 CDD:306579 5/21 (24%)
C2H2 Zn finger 367..387 CDD:275368 5/19 (26%)
COG5048 <378..>492 CDD:227381 38/115 (33%)
C2H2 Zn finger 395..415 CDD:275368 6/21 (29%)
C2H2 Zn finger 423..443 CDD:275368 6/19 (32%)
C2H2 Zn finger 451..471 CDD:275368 8/19 (42%)
C2H2 Zn finger 479..499 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.