DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZKSCAN1

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001333510.1 Gene:ZKSCAN1 / 7586 HGNCID:13101 Length:563 Species:Homo sapiens


Alignment Length:161 Identity:56/161 - (34%)
Similarity:82/161 - (50%) Gaps:4/161 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELT 188
            |..::....:.:..||..:.|.:||:.....|:...|.:.|||.|.:.|  ..|.::|:....|.
Human   359 SLSSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYEC--SECGKAFSLNSNLV 421

  Fly   189 SHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDA 253
            .|.||||||:|:.|..|.:.||.|.....|.|.|..|:.|||:.|.|:|..|..|.||:.||...
Human   422 LHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGE 486

  Fly   254 RNHYCYVCQKHFKRISHLMTHLSSNIHKRKE 284
            :.:.|..|.|.|.|.|:|:.|  ..||.|::
Human   487 KPYECSECGKAFNRNSYLILH--RRIHTREK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 11/29 (38%)
C2H2 Zn finger 258..280 CDD:275368 8/21 (38%)
ZKSCAN1NP_001333510.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
SCAN 52..162 CDD:128708
KRAB_A-box 227..262 CDD:143639
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..373 1/13 (8%)
C2H2 Zn finger 355..371 CDD:275368 1/11 (9%)
COG5048 <356..537 CDD:227381 56/161 (35%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)
C2H2 Zn finger 407..427 CDD:275368 6/21 (29%)
C2H2 Zn finger 435..455 CDD:275368 7/19 (37%)
C2H2 Zn finger 463..483 CDD:275368 8/19 (42%)
C2H2 Zn finger 491..511 CDD:275368 8/21 (38%)
C2H2 Zn finger 519..539 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.