DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF10

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_056209.2 Gene:ZNF10 / 7556 HGNCID:12879 Length:573 Species:Homo sapiens


Alignment Length:187 Identity:62/187 - (33%)
Similarity:89/187 - (47%) Gaps:20/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DESILCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTG-----PYVCPDCGRIINNKSNFQEHTLR 163
            |:|..||:             ...||.|..|:|...|     ||.|.:||:..:.:||...|.|.
Human   235 DKSYKCPD-------------NDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNLTRHQLI 286

  Fly   164 HTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRY 228
            |||.|.:.|  ..|.:||:....|..|.:.||||:||.|..|.:.||.......|.|.|..::.|
Human   287 HTGEKPYEC--KECGKSFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLY 349

  Fly   229 ECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEE 285
            .|:.|.||||.|..|.:|:..|...:.:.|..|.|.|::.:||:.|..:::..|..|
Human   350 TCNQCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 11/24 (46%)
UFD2 <256..>294 CDD:227443 9/30 (30%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
ZNF10NP_056209.2 KRAB 14..73 CDD:214630
C2H2 Zn finger 213..232 CDD:275368
C2H2 Zn finger 267..287 CDD:275368 7/19 (37%)
COG5048 <272..474 CDD:227381 47/137 (34%)
C2H2 Zn finger 295..315 CDD:275368 6/21 (29%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 351..371 CDD:275368 9/19 (47%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 407..427 CDD:275368 62/187 (33%)
C2H2 Zn finger 435..455 CDD:275368
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 547..567 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.