DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF3

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001305065.1 Gene:ZNF3 / 7551 HGNCID:13089 Length:453 Species:Homo sapiens


Alignment Length:152 Identity:57/152 - (37%)
Similarity:78/152 - (51%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRI 193
            :.||: |..|..||.|.:||:..:..|:..:|...|||.|.:.|  .:|.::|:....|..|.||
Human   223 IQHQR-IHTGEKPYECNECGKAFSQSSHLIQHQRIHTGEKPYEC--SDCGKTFSCSSALILHRRI 284

  Fly   194 HTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYC 258
            ||||:||.|..|.:.||.|.....|.|.|..|:.|.|:.|.|:|..|..|..|:.||...:.:.|
Human   285 HTGEKPYECNECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYEC 349

  Fly   259 YVCQKHFKRISHLMTHLSSNIH 280
            ..|.|.|.:.|||..|  ..||
Human   350 NECGKAFSQSSHLYQH--QRIH 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 10/25 (40%)
C2H2 Zn finger 258..280 CDD:275368 8/21 (38%)
ZNF3NP_001305065.1 KRAB 57..98 CDD:366587
COG5048 <182..360 CDD:227381 51/139 (37%)
C2H2 Zn finger 185..201 CDD:275368
C2H2 Zn finger 209..229 CDD:275368 2/6 (33%)
C2H2 Zn finger 237..257 CDD:275368 5/19 (26%)
C2H2 Zn finger 265..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
C2H2 Zn finger 321..341 CDD:275368 7/19 (37%)
C2H2 Zn finger 349..369 CDD:275368 8/21 (38%)
zf-H2C2_2 361..386 CDD:372612 5/11 (45%)
C2H2 Zn finger 377..397 CDD:275368
zf-H2C2_2 390..414 CDD:372612
C2H2 Zn finger 405..425 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.