DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF574

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001317448.1 Gene:ZNF574 / 64763 HGNCID:26166 Length:986 Species:Homo sapiens


Alignment Length:279 Identity:72/279 - (25%)
Similarity:117/279 - (41%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSRSDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQ-RCIIA 69
            ||.|.||            .|:|::..:..:.:...::  ...|.:|.....::::.|: ||..|
Human   699 CRECPRS------------FLLRRLLEVHQLVVHAGRQ--PHRCPSCGAAFPSSLRLREHRCAAA 749

  Fly    70 EKQNLERIECDSKDCSTDPIIYEDIDDNQIES-------ELDESILCP-EV--KDLPMPSAEK-- 122
            ..|...|.||.:  |.           .::.|       |...:...| ||  |:.|.|.|.:  
Human   750 AAQAPRRFECGT--CG-----------KKVGSAARLQAHEAAHAAAGPGEVLAKEPPAPRAPRAT 801

  Fly   123 ---VSAPTSLNHQKSIGGGTGP-----YVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCER 179
               |::|.:|. ..:......|     ..|.:|.::.:.:::.|.|...|||.:.:.|.  :|.:
Human   802 RAPVASPAALG-STATASPAAPARRRGLECSECKKLFSTETSLQVHRRIHTGERPYPCP--DCGK 863

  Fly   180 SFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLR 244
            :|.....|..|.|:||||:|:.|..|.:.|:.|....||.|.|..||.|.|..|.||:.|...|.
Human   864 AFRQSTHLKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPYSCPDCGKSYRSFSNLW 928

  Fly   245 KHKMIHVDARNHYCYVCQK 263
            ||:..|  .:.|...|.|:
Human   929 KHRKTH--QQQHQAAVRQQ 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 14/70 (20%)
C2H2 Zn finger 144..164 CDD:275368 4/19 (21%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 11/24 (46%)
UFD2 <256..>294 CDD:227443 3/8 (38%)
C2H2 Zn finger 258..280 CDD:275368 2/6 (33%)
ZNF574NP_001317448.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.