DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and Zfp24

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001344376.1 Gene:Zfp24 / 59057 MGIID:1929704 Length:368 Species:Mus musculus


Alignment Length:299 Identity:69/299 - (23%)
Similarity:117/299 - (39%) Gaps:72/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSRSDAPIDLFGPGNGHLVRQIHSITGVE---LSCKKEI----------SGQMCTTCLDNLQ 57
            ||:..|.:.          |...||..:..:|   ....||:          :|:.....|::|:
Mouse    77 CRLWLRPET----------HTKEQILELVVLEQFVAILPKELQTWVREHHPENGEEAVAVLEDLE 131

  Fly    58 A---------AIKFRQRCIIAEK------------QNLERIECDSKDCSTDPIIYEDIDDNQIES 101
            :         :::.::|.::.|:            ..|:.:|...|..|.:.......||   ::
Mouse   132 SELDDPGQPVSLRRQKREVLVEEITSQEDAQGLPSSELDAVENQLKWASWELHSLRHCDD---DA 193

  Fly   102 ELDESILCPEVKDLPMPSA-EKVSAPTSLN-------------------HQKSIGGGTGPYVCPD 146
            ..:...|.|:.:   |.|| |....|.:||                   .:|........::|.:
Mouse   194 TTENGALAPKQE---MASAGESHEGPGTLNIGVPQLFKYGETCFPKGRFERKRNPSRKKQHICDE 255

  Fly   147 CGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSS 211
            ||:..:..|....|...|:|.|.:.||  .|.::|:....|..|.|:||||:||.|:.|.:.||.
Mouse   256 CGKHFSQGSALILHQRIHSGEKPYGCV--ECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQ 318

  Fly   212 SGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIH 250
            :.....|.|.|..|:.|||..|.||:..|..|.:|:..|
Mouse   319 NSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRH 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 15/103 (15%)
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 7/21 (33%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443
C2H2 Zn finger 258..280 CDD:275368
Zfp24NP_001344376.1 SCAN 48..159 CDD:128708 14/91 (15%)
COG5048 <249..329 CDD:227381 27/81 (33%)
Necessary and sufficient for nuclear localization. /evidence=ECO:0000250 251..301 15/51 (29%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
C2H2 Zn finger 281..301 CDD:275368 7/21 (33%)
COG5048 305..>358 CDD:227381 20/53 (38%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.