DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF286A

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001275571.1 Gene:ZNF286A / 57335 HGNCID:13501 Length:564 Species:Homo sapiens


Alignment Length:174 Identity:59/174 - (33%)
Similarity:86/174 - (49%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCV 173
            |.|.|       :..:..:||...:.|..|..||.|.:||:..|..::..:|.|.|||:|.:.| 
Human   343 CSECK-------KTFTESSSLATHQRIHVGERPYECNECGKGFNRSTHLVQHQLIHTGVKPYEC- 399

  Fly   174 FLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFV 238
             ..|:::|.....|..|.|.||||:||.|..|.:.||...:..:|.|.|..|:.|||..|.|:|.
Human   400 -NECDKAFIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFS 463

  Fly   239 SSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKR 282
            .|..|.:|:.||...:.:.|..|.|.|.|.|:...|...:|.|:
Human   464 QSTHLVQHQRIHTGEKPYECNECGKTFSRSSNFAKHQRIHIGKK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 9/27 (33%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
ZNF286ANP_001275571.1 KRAB 88..141 CDD:214630
KRAB 88..123 CDD:279668
COG5048 <265..400 CDD:227381 20/65 (31%)
C2H2 Zn finger 288..308 CDD:275368
zf-H2C2_2 301..325 CDD:290200
C2H2 Zn finger 316..336 CDD:275368
C2H2 Zn finger 343..363 CDD:275368 5/26 (19%)
zf-H2C2_2 355..380 CDD:290200 9/24 (38%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
zf-H2C2_2 383..406 CDD:290200 8/24 (33%)
COG5048 <395..550 CDD:227381 41/115 (36%)
zf-C2H2 397..419 CDD:278523 6/23 (26%)
C2H2 Zn finger 399..419 CDD:275368 6/21 (29%)
zf-H2C2_2 411..436 CDD:290200 12/24 (50%)
C2H2 Zn finger 427..447 CDD:275368 6/19 (32%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
zf-H2C2_2 467..492 CDD:290200 8/24 (33%)
C2H2 Zn finger 483..503 CDD:275368 7/19 (37%)
zf-H2C2_2 495..518 CDD:290200 3/13 (23%)
C2H2 Zn finger 511..531 CDD:275368
zf-H2C2_2 523..548 CDD:290200
C2H2 Zn finger 539..559 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.