DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF444

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_060807.2 Gene:ZNF444 / 55311 HGNCID:16052 Length:327 Species:Homo sapiens


Alignment Length:184 Identity:47/184 - (25%)
Similarity:69/184 - (37%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFA 182
            |..::.|:|.......:.....|...||:||:               |.:|..|           
Human   155 PYKQEPSSPPLAPGLPAFLAAPGTTSCPECGK---------------TSLKPAH----------- 193

  Fly   183 TRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRN-------------------ERRY 228
                |..|.:.|:||:|:.|..|.:.|    .|:||.||||:                   |:.:
Human   194 ----LLRHRQSHSGEKPHACPECGKAF----RRKEHLRRHRDTHPGSPGSPGPALRPLPAREKPH 250

  Fly   229 ECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKR 282
            .|..|.|:|.....|.:|:..|..||...|:.|.|.|.|..|::.|  ..||.|
Human   251 ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRH--QRIHGR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 4/19 (21%)
C2H2 Zn finger 172..194 CDD:275368 2/21 (10%)
zf-H2C2_2 186..211 CDD:290200 9/24 (38%)
UFD2 <256..>294 CDD:227443 10/27 (37%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
ZNF444NP_060807.2 SCAN 21..98 CDD:366881
PRK14959 <60..>182 CDD:184923 4/26 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..171 3/15 (20%)
COG5048 <179..>280 CDD:227381 33/134 (25%)
C2H2 Zn finger 181..201 CDD:275368 9/49 (18%)
C2H2 Zn finger 209..229 CDD:275368 10/23 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..243 6/22 (27%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
zf-C2H2 278..300 CDD:333835 7/23 (30%)
C2H2 Zn finger 280..300 CDD:275368 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.