DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and CG1792

DIOPT Version :10

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:331 Identity:96/331 - (29%)
Similarity:136/331 - (41%) Gaps:57/331 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NCRICSR---SDAPIDLFGPGNGHLVRQIHSITGVEL--SCKKEISGQMCTTCLDNLQAAIKFRQ 64
            |||.|..   ...|.:||...|..::.||..:||:.|  ....|:...:|:.|..:||.||.||:
  Fly     5 NCRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRE 69

  Fly    65 RCIIAEKQ--------NLERIECDSKDCSTDPIIYEDIDDNQIESELDESILCPEVKD------- 114
            |.|..:|.        |.|.||..:.....:....|::.:.::...|.|..|..|.::       
  Fly    70 RVIRTQKTLQESPNLGNAELIESFAVGVEKEIQYAEEVTEIEVIDLLPEEHLLEETEEPYEICEQ 134

  Fly   115 -----LPMPSAEK------VSAPTSLNHQKSIGGGTG-----------------------PYVCP 145
                 :.:|:.||      .:.||.....|.......                       ..:|.
  Fly   135 NEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICE 199

  Fly   146 DCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFS 210
            .|||.....|||:.|.|||||:|:|.|.  .|.:.|.|...|..|..:|.|...:.|.||...:|
  Fly   200 QCGRHFTCPSNFKLHLLRHTGVKSFACD--QCSQQFYTATLLRRHQELHAGNALFQCRYCEATYS 262

  Fly   211 SSGARQEHHR-RHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTH 274
            ::..|.:|.| ||.|.:.:.|..|.|||..||.||.|.:.|...|..:|..||..|.|.|||.:|
  Fly   263 NASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSH 327

  Fly   275 LSSNIH 280
            ..|..|
  Fly   328 YRSKGH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 5..76 CDD:462262 26/83 (31%)
C2H2 Zn finger 144..164 CDD:275368 9/19 (47%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
UFD2 <256..>294 CDD:227443 11/25 (44%)
C2H2 Zn finger 258..280 CDD:275368 10/21 (48%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 24/73 (33%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
C2H2 Zn finger 226..243 CDD:275368 5/18 (28%)
SUF4-like 254..>301 CDD:411020 20/46 (43%)
C2H2 Zn finger 254..275 CDD:411020 7/20 (35%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 283..303 CDD:275368 10/19 (53%)
C2H2 Zn finger 283..301 CDD:411020 10/17 (59%)
zf-H2C2_2 296..320 CDD:463886 9/23 (39%)
zf-met 309..333 CDD:463736 10/23 (43%)
C2H2 Zn finger 311..329 CDD:275368 9/17 (53%)

Return to query results.
Submit another query.