DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6813 and wdn

DIOPT Version :9

Sequence 1:	NP_001163590.1	Gene:	CG6813 / 41396	FlyBaseID:	FBgn0037923	Length:	294	Species:	Drosophila melanogaster
Sequence 2:	NP_476900.1	Gene:	wdn / 43398	FlyBaseID:	FBgn0005642	Length:	869	Species:	Drosophila melanogaster

Alignment Length:	137	Identity:	50/137 - (36%)
Similarity:	69/137 - (50%)	Gaps:	5/137 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   144 CPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRR 208
            |||||:.:...|.:. |...|:..|.:.|..  |.:.|..:..||.|.|||:.|:||.|..|.:|
  Fly   333 CPDCGKCLKLGSMWM-HRKIHSDNKKYQCDI--CGQKFVQKINLTHHARIHSSEKPYECPECQKR 394

  Fly   209 FSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMT 273
            |......|.|.:.|...|.|.|:.|.|.:.:..||:.|.::|::.|...|.||.|.|...|.|..
  Fly   395 FQERSHLQRHQKYHAQTRSYRCEKCGKMYKTERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQ 459

  Fly   274 HLSSNIH 280
            |  ||||
  Fly   460 H--SNIH 464

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6813	NP_001163590.1	zf-AD	6..76	CDD:285071
		C2H2 Zn finger	144..164	CDD:275368	7/19 (37%)
		C2H2 Zn finger	172..194	CDD:275368	7/21 (33%)
		zf-H2C2_2	186..211	CDD:290200	13/24 (54%)
		UFD2	<256..>294	CDD:227443	12/25 (48%)
		C2H2 Zn finger	258..280	CDD:275368	10/21 (48%)
wdn	NP_476900.1	C2H2 Zn finger	301..321	CDD:275368
		RPB9	333..425	CDD:224510	33/94 (35%)
		C2H2 Zn finger	333..352	CDD:275368	7/19 (37%)
		zf-H2C2_2	344..369	CDD:290200	7/27 (26%)
		zf-C2H2	358..380	CDD:278523	7/23 (30%)
		C2H2 Zn finger	360..380	CDD:275368	7/21 (33%)
		zf-H2C2_2	372..395	CDD:290200	11/22 (50%)
		zf-C2H2	386..408	CDD:278523	7/21 (33%)
		C2H2 Zn finger	388..436	CDD:275368	15/47 (32%)
		zf-H2C2_2	400..425	CDD:290200	8/24 (33%)
		C2H2 Zn finger	416..433	CDD:275368	5/16 (31%)
		zf-H2C2_2	429..453	CDD:290200	9/23 (39%)
		C2H2 Zn finger	444..464	CDD:275368	10/21 (48%)
		zf-H2C2_2	457..481	CDD:290200	6/10 (60%)
		C2H2 Zn finger	472..493	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45457205
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930