Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
Alignment Length: | 402 | Identity: | 96/402 - (23%) |
---|---|---|---|
Similarity: | 141/402 - (35%) | Gaps: | 128/402 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 CRICSRSDAP-----IDLFG-PGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQ 64
Fly 65 RC---------------------------IIAEKQNLERI-------------------ECDS-- 81
Fly 82 -------KDCSTDPIIYEDIDD------NQIE-----SELDESIL-----CPEVKD--------- 114
Fly 115 -LPMPSAEKVSA----------PTSLNHQKSIGGGTGP--------------------------- 141
Fly 142 YVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCP 206
Fly 207 RRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHL 271
Fly 272 MTHLSSNIHKRK 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | 20/102 (20%) |
C2H2 Zn finger | 144..164 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 12/24 (50%) | ||
UFD2 | <256..>294 | CDD:227443 | 9/28 (32%) | ||
C2H2 Zn finger | 258..280 | CDD:275368 | 6/21 (29%) | ||
trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | 17/74 (23%) |
COG5048 | <264..411 | CDD:227381 | 53/150 (35%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 287..311 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 315..338 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 345..367 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 370..394 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 6/21 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |