DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and sqz

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster


Alignment Length:211 Identity:62/211 - (29%)
Similarity:90/211 - (42%) Gaps:30/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 ELDESILCPEVKDLPMPSAEKVSAP--TSLNHQKSIGGGTG-------------------PYVCP 145
            :|..|...|.....|....|:...|  :....|.|...|:|                   ||.|.
  Fly    97 QLKVSYSAPNSPPTPHEQQEQKYDPNRSPPRQQMSSASGSGSNGSSPEEESRRGDGDQAKPYKCG 161

  Fly   146 DCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVY--CPRR 208
            .|.:...|.|...:||..|.|||.:.|..  |:|.|.....|..|.|.|||::||.|.:  ||:.
  Fly   162 SCSKSFANSSYLSQHTRIHLGIKPYRCEI--CQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKA 224

  Fly   209 FSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARN---HYCYVCQKHFKRISH 270
            ||.....|.|.|.|:.::.::|::|.|.|.....|.:|...|.|:::   |.|.:|.|.:.:.::
  Fly   225 FSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKSYTQETY 289

  Fly   271 LMTHLSSNIHKRKEEK 286
            |..||..  |..|.||
  Fly   290 LQKHLQK--HAEKAEK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 7/21 (33%)
zf-H2C2_2 186..211 CDD:290200 12/26 (46%)
UFD2 <256..>294 CDD:227443 11/31 (35%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
zf-H2C2_2 172..197 CDD:290200 10/26 (38%)
zf-C2H2 186..208 CDD:278523 7/23 (30%)
C2H2 Zn finger 188..208 CDD:275368 7/21 (33%)
zf-C2H2_8 191..271 CDD:292531 28/79 (35%)
zf-H2C2_2 200..227 CDD:290200 12/26 (46%)
C2H2 Zn finger 216..238 CDD:275368 8/21 (38%)
C2H2 Zn finger 246..266 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.