DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and CG6808

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster


Alignment Length:360 Identity:84/360 - (23%)
Similarity:134/360 - (37%) Gaps:89/360 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSR--SDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRC-- 66
            ||.|.:  :.:.:......|.|  :.:.|..|..:.....:..|:||.||..|:...:|...|  
  Fly    10 CRTCRKKGTQSTLQSLFESNAH--KLLISYAGTSVKPDDGLPDQICTVCLMQLEEVDRFLSACKQ 72

  Fly    67 --------------------IIAEKQNLERIECDSKDCSTDPIIYED-----IDDNQIESELDES 106
                                .:.:|..||:.:...|...:..:|.|:     ..:|.:|:..|:.
  Fly    73 SDAHLRSLVRQTLSSASAFETLEDKDQLEQKKRARKQNISGRLIEENPINFKTQENALETTKDDE 137

  Fly   107 IL----------------CPEVKDLPMPS---------------------AEKVSAPT------- 127
            ||                ....||:....                     :::.||.|       
  Fly   138 ILPINKFSSDFVFDLNVNAENEKDIHQEDYTISDMDLDREISDQNYSETYSQESSAATDSIQETS 202

  Fly   128 --------SLNHQKSIGGGTGP--YVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFA 182
                    |.::...:|....|  |.|..|.......|....|:..|...|:..|..  |:::|.
  Fly   203 EDYHNLEPSADYVIDLGVACEPDKYRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEV--CQKTFR 265

  Fly   183 TRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHK 247
            ....|.:|.|.||||:||.|.||.|||:.:...::|.|.|.|||.|.|:.|.|:|..|.....|.
  Fly   266 AACNLKTHMRTHTGEKPYQCCYCSRRFADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHY 330

  Fly   248 MIHVDARNHYCYVCQKHFKRISHLMT-HLSSNIHK 281
            .:|...::|.|.:|:|.| |:.|.:| |..|..|:
  Fly   331 YLHSSEKSHKCLMCKKEF-RLKHQLTAHEKSLAHR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 17/93 (18%)
C2H2 Zn finger 144..164 CDD:275368 4/19 (21%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 15/24 (63%)
UFD2 <256..>294 CDD:227443 11/27 (41%)
C2H2 Zn finger 258..280 CDD:275368 9/22 (41%)
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 15/70 (21%)
C2H2 Zn finger 229..249 CDD:275368 4/19 (21%)
zf-C2H2 255..277 CDD:278523 6/23 (26%)
C2H2 Zn finger 257..277 CDD:275368 6/21 (29%)
zf-H2C2_2 269..293 CDD:290200 14/23 (61%)
C2H2 Zn finger 285..305 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
C2H2 Zn finger 341..359 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.