DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and CG4820

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:372 Identity:94/372 - (25%)
Similarity:140/372 - (37%) Gaps:101/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSR---SDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRCI 67
            ||.|.:   :|..:.:|.|....|::.:.|||...|...:::...:||.|...|....|||:||.
  Fly     5 CRTCGKTVVADECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQKFRRRCA 69

  Fly    68 IAEK--------QNLE---------RIE-------------CDSKDCSTDPIIYEDIDDNQI--- 99
            ..||        .||.         |::             ..:.|...:||..:..:|.|.   
  Fly    70 KIEKYFARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGIDELMSASDIKIEPIQLQMEEDPQAPYP 134

  Fly   100 ESELDESIL---CPEVKDLPMPS----------------AEKVSAPTS--------------LNH 131
            |::|::::.   .|....||:|.                |::.|..|:              |.|
  Fly   135 ENQLEQALSYGNAPGEDILPLPEDYGEAQTEVATTTNEPAQRRSKNTAKIKSKKHTMRVGRKLIH 199

  Fly   132 QKSI------------GGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATR 184
            .|.|            |....|.:|..|||...:.||...|.|||||.|.|.|.  .|.:...|.
  Fly   200 VKVIDDKQPKRIVDRNGPSAKPCICEHCGRQFKDTSNLHVHLLRHTGTKPFECD--QCHQKCYTL 262

  Fly   185 KELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMI 249
            ..|..|...|| |.||.|.:|...:|::.:|..|.|          :.|||......   |.::|
  Fly   263 HLLRRHQLKHT-EGPYACTFCGLEYSTNSSRVRHER----------EACKKGRAPQS---KWEII 313

  Fly   250 HVDARNHYCYVCQKHFKRISHLMTHLSSNIH----KRKEEKLTELAI 292
            ....|..:|.||...|.|..:...|::|:.|    :||:.|....||
  Fly   314 KKGERTFHCEVCDLWFLRAGNFTQHINSSSHIENERRKKRKSNPTAI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 24/89 (27%)
C2H2 Zn finger 144..164 CDD:275368 8/19 (42%)
C2H2 Zn finger 172..194 CDD:275368 5/21 (24%)
zf-H2C2_2 186..211 CDD:290200 9/24 (38%)
UFD2 <256..>294 CDD:227443 13/41 (32%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 22/69 (32%)
C2H2 Zn finger 224..244 CDD:275368 8/19 (42%)
C2H2 Zn finger 252..272 CDD:275368 5/21 (24%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.