DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ranshi

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster


Alignment Length:335 Identity:96/335 - (28%)
Similarity:149/335 - (44%) Gaps:56/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSR---SDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRCI 67
            ||.|.:   ::..:::|...|...:..|..:||..|.....:..::|.:|...||.||.||:||:
  Fly     6 CRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERCL 70

  Fly    68 IAEKQNL----------------------ERIECDSKDCSTDPIIYEDIDDNQIESE-------L 103
            ..:::.|                      |.:|.|..:.|.:....:|:::..|:|.       |
  Fly    71 EVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDIL 135

  Fly   104 DES------------ILCPEVKDLPMPSAEKVSA----------PTSLNHQKSIGGGTGPYVCPD 146
            :||            |...|:..|...|..:|.|          |....::::.......:.|.:
  Fly   136 NESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEE 200

  Fly   147 CGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSS 211
            ||..|.::.:|..|..||.|:|.|.|.|  ||..|.|..||..|.|.||||:|:.|.:|.|.||.
  Fly   201 CGNHIKDRISFILHCKRHRGVKEFGCEF--CEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSD 263

  Fly   212 SGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLS 276
            ...|.:|.|.|.|||.:.|..|..:|.:|..|:.|.::|...:...|.:|.|.|.|.:||.||..
  Fly   264 YSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYR 328

  Fly   277 SNIHKRKEEK 286
            ||.|:|..:|
  Fly   329 SNAHRRNMQK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 20/94 (21%)
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 10/21 (48%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 14/31 (45%)
C2H2 Zn finger 258..280 CDD:275368 11/21 (52%)
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 19/70 (27%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 26/55 (47%)
C2H2 Zn finger 226..246 CDD:275368 10/21 (48%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 7/23 (30%)
C2H2 Zn finger 310..328 CDD:275368 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.