DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ouib

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:326 Identity:102/326 - (31%)
Similarity:156/326 - (47%) Gaps:59/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILN--CRICSRS---DAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKF 62
            :||  ||:|.|.   :..::||...|...::.:|.|:|:.|....::.|.||..|...|::|:.|
  Fly     1 MLNIVCRVCGRQKICEKSLNLFDLVNRKYLKHLHMISGLRLVDLDDVPGFMCLCCQAELRSALAF 65

  Fly    63 RQRCIIAEKQNLERIECDSKDCSTDPIIYEDIDDN-QIES--------------ELDESILCPEV 112
            |:.||..:.:.| .||.||.  |.|    ||.:|| ::||              ||.|......:
  Fly    66 RKLCIKTQTKWL-TIEDDSS--SGD----EDTNDNSELESEKCAFSDFGKKKEGELVEETFQVLI 123

  Fly   113 KDLPM----------------------PSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKS 155
            ::.||                      ||.:.:...|.|:.|        .|:|..||....:|.
  Fly   124 EEEPMDKTLNRDAKAQLREDGIDEKCVPSQKIIKVSTKLDDQ--------IYICELCGTHATSKP 180

  Fly   156 NFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHR 220
            .||.|..:|.|.:.|.|  .:|:..|.:..||.:|.|:||||||:.|.:|.:|:.|...|..|.|
  Fly   181 TFQRHMRKHRGERPFGC--KDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVSYMGRLIHER 243

  Fly   221 RHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEE 285
            .|.|:|.|.|:.|.|.|.::..|:.|.:||...||..|.:|.:.|:|.:||:||..|.:|.:..:
  Fly   244 THTNDRPYVCEECGKKFTTAYVLKNHMVIHTGERNFRCDICDRSFQRKAHLVTHTRSMMHLQNVK 308

  Fly   286 K 286
            |
  Fly   309 K 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 22/72 (31%)
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 7/21 (33%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 11/31 (35%)
C2H2 Zn finger 258..280 CDD:275368 9/21 (43%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871 22/73 (30%)
COG5048 <158..300 CDD:227381 56/151 (37%)
C2H2 Zn finger 169..189 CDD:275368 7/19 (37%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 209..234 CDD:290200 13/24 (54%)
C2H2 Zn finger 225..245 CDD:275368 7/19 (37%)
zf-H2C2_2 241..262 CDD:290200 10/20 (50%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 8/21 (38%)
C2H2 Zn finger 281..299 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.