DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and nom

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:336 Identity:97/336 - (28%)
Similarity:151/336 - (44%) Gaps:57/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRILNCRICSRS---DAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKF 62
            |.|..||:|.||   ...::||.||...::|:|..|||:.|.........:|..|..:||:|:.|
  Fly     1 MLINVCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIF 65

  Fly    63 RQRCIIAEKQNLERIECDSKDCS-------TDPI------------------IYEDIDDNQIESE 102
            |::||:.:|:.:..::.|....|       .||.                  |.:.:..|:.::.
  Fly    66 RRQCILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLEIVDIVVTNESKAS 130

  Fly   103 LDESILCPE-------------------VKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCG 148
            ..||:...|                   ::::.:|..:.:.:...|.:.:.       :.|..||
  Fly   131 AGESVGGDEFDQPVEISNEPDATDSDVNLEEIDLPDEDGLESDHDLPNVQI-------HKCDTCG 188

  Fly   149 RIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRI-HTGEQPYVCVYCPRRFSSS 212
            .|.||||:...|...|.||:.:.|  ..|.::|....||.:|... ||.|.|:.|.||.||:.|.
  Fly   189 IIKNNKSSLVRHQFEHNGIRPYPC--KECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSV 251

  Fly   213 GARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSS 277
            ..|::|.|.|.|||.:.||.|.|:|..:..|:.|..:|...|.:.|.||.:.|....||.||..|
  Fly   252 VGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFIS 316

  Fly   278 NIHKRKEEKLT 288
            |.|||..|.:|
  Fly   317 NTHKRNAEAVT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 25/72 (35%)
C2H2 Zn finger 144..164 CDD:275368 9/19 (47%)
C2H2 Zn finger 172..194 CDD:275368 6/22 (27%)
zf-H2C2_2 186..211 CDD:290200 12/25 (48%)
UFD2 <256..>294 CDD:227443 15/33 (45%)
C2H2 Zn finger 258..280 CDD:275368 10/21 (48%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 25/70 (36%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
C2H2 Zn finger 212..261 CDD:275368 19/50 (38%)
zf-H2C2_2 255..278 CDD:290200 11/22 (50%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 7/22 (32%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.