DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and Zif

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:372 Identity:89/372 - (23%)
Similarity:143/372 - (38%) Gaps:87/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRIC-------SRSDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFR 63
            ||:|       .|.|...:........::.|:..::...|:.::.|...:|.:|...|..|.:||
  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQFR 74

  Fly    64 QRCI---------------------------------------------------IAEKQNLERI 77
            ::.:                                                   ..||.:.|.:
  Fly    75 EKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYL 139

  Fly    78 ECDSKD---CSTDPIIYEDIDDN---QIESELDESILCPEVKDLPMPS---AEKVSAPTSLNHQK 133
            |.|:.|   |..|.|.|  ::||   ::.|:..|.:|..|.:....||   |.:.:|..||..::
  Fly   140 EVDTSDQQECIGDTIEY--LEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKARR 202

  Fly   134 ------------SIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKE 186
                        |.|...|.|:|..||.....:....||..||.||..:.|..  |:..|..|::
  Fly   203 GRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACEL--CDAKFQVREQ 265

  Fly   187 LTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHV 251
            |..|...|||.:||.|.:|.|:|......:.|...||..:.|.|..|.|:|..:..|.||::||.
  Fly   266 LRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHS 330

  Fly   252 DARNHYCYVCQKHFKRISHLMTHLSSNIHKR----KEEKLTELAIEQ 294
            |.:.:.|..|.|.|:.:.|:..|..:.:|:.    .|....|:..||
  Fly   331 DIKLYRCDYCNKDFRLLHHMRQHEETKLHQNAVMLAESMKVEMVAEQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 16/127 (13%)
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 11/24 (46%)
UFD2 <256..>294 CDD:227443 9/41 (22%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 14/76 (18%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
COG5048 <250..369 CDD:227381 37/120 (31%)
C2H2 Zn finger 253..273 CDD:275368 6/21 (29%)
zf-H2C2_2 266..288 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
zf-H2C2_2 294..318 CDD:290200 8/23 (35%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
C2H2 Zn finger 337..353 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.