DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and MTF-1

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster


Alignment Length:236 Identity:63/236 - (26%)
Similarity:109/236 - (46%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CSTDPIIYEDIDDNQIESELDESILCPEVKDLPMPSAEKVSAPTSLNHQ------KSIGG----- 137
            |....::::|:|:.::|.: ||:   .::..|...|:::..:....|::      .:||.     
  Fly   290 CIQPGVLHQDVDEEEVERQ-DEN---DQLMALAYESSDEALSRYRCNYENCYRSYSTIGNLRTHL 350

  Fly   138 --GTGPY--VCPD--CGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTG 196
              .||.|  .||:  |.:......:.:.|...||.:|.:.|....|:::|.||..|.:|.|:|.|
  Fly   351 KTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKAFNTRYRLHAHLRLHNG 415

  Fly   197 EQPYVCVYCPRRFSSSGARQEHHRRHRNERRYEC--DTCKKSFVSSGCLRKHKMIHVDARNHYCY 259
            | .:.|..|.:.|::....::|.|.|..||.|:|  |.|.|:|.:|..|:.|:..|...:.:.|.
  Fly   416 E-TFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRTHTGEKPYPCQ 479

  Fly   260 --VCQKHFKRISHLMTHLSSNIHKR----KEEKLTELAIEQ 294
              .|||.|.....|.:|  ...|:|    |..|...|..:|
  Fly   480 EDSCQKSFSTSHSLKSH--KKTHQRQLQNKGRKKRPLKTQQ 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 4/21 (19%)
C2H2 Zn finger 172..194 CDD:275368 8/21 (38%)
zf-H2C2_2 186..211 CDD:290200 9/24 (38%)
UFD2 <256..>294 CDD:227443 12/43 (28%)
C2H2 Zn finger 258..280 CDD:275368 7/23 (30%)
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 41/142 (29%)
C2H2 Zn finger 331..353 CDD:275368 3/21 (14%)
zf-H2C2_2 345..372 CDD:290200 6/26 (23%)
C2H2 Zn finger 361..383 CDD:275368 4/21 (19%)
zf-H2C2_2 375..402 CDD:290200 7/26 (27%)
C2H2 Zn finger 391..413 CDD:275368 8/21 (38%)
zf-C2H2 418..440 CDD:278523 5/21 (24%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
zf-H2C2_2 432..458 CDD:290200 10/25 (40%)
COG5048 442..>519 CDD:227381 25/79 (32%)
C2H2 Zn finger 448..470 CDD:275368 8/21 (38%)
zf-H2C2_2 462..489 CDD:290200 8/26 (31%)
C2H2 Zn finger 478..500 CDD:275368 7/23 (30%)
DUF3682 862..>931 CDD:289231
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.