Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097560.1 | Gene: | MTF-1 / 39089 | FlyBaseID: | FBgn0040305 | Length: | 1006 | Species: | Drosophila melanogaster |
Alignment Length: | 236 | Identity: | 63/236 - (26%) |
---|---|---|---|
Similarity: | 109/236 - (46%) | Gaps: | 32/236 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 CSTDPIIYEDIDDNQIESELDESILCPEVKDLPMPSAEKVSAPTSLNHQ------KSIGG----- 137
Fly 138 --GTGPY--VCPD--CGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTG 196
Fly 197 EQPYVCVYCPRRFSSSGARQEHHRRHRNERRYEC--DTCKKSFVSSGCLRKHKMIHVDARNHYCY 259
Fly 260 --VCQKHFKRISHLMTHLSSNIHKR----KEEKLTELAIEQ 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | |
C2H2 Zn finger | 144..164 | CDD:275368 | 4/21 (19%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 9/24 (38%) | ||
UFD2 | <256..>294 | CDD:227443 | 12/43 (28%) | ||
C2H2 Zn finger | 258..280 | CDD:275368 | 7/23 (30%) | ||
MTF-1 | NP_001097560.1 | zf-C2H2_aberr | 329..471 | CDD:293622 | 41/142 (29%) |
C2H2 Zn finger | 331..353 | CDD:275368 | 3/21 (14%) | ||
zf-H2C2_2 | 345..372 | CDD:290200 | 6/26 (23%) | ||
C2H2 Zn finger | 361..383 | CDD:275368 | 4/21 (19%) | ||
zf-H2C2_2 | 375..402 | CDD:290200 | 7/26 (27%) | ||
C2H2 Zn finger | 391..413 | CDD:275368 | 8/21 (38%) | ||
zf-C2H2 | 418..440 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 420..440 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 432..458 | CDD:290200 | 10/25 (40%) | ||
COG5048 | 442..>519 | CDD:227381 | 25/79 (32%) | ||
C2H2 Zn finger | 448..470 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 462..489 | CDD:290200 | 8/26 (31%) | ||
C2H2 Zn finger | 478..500 | CDD:275368 | 7/23 (30%) | ||
DUF3682 | 862..>931 | CDD:289231 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45457152 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |