| Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_061983.2 | Gene: | ZKSCAN4 / 387032 | HGNCID: | 13854 | Length: | 545 | Species: | Homo sapiens |
| Alignment Length: | 228 | Identity: | 69/228 - (30%) |
|---|---|---|---|
| Similarity: | 99/228 - (43%) | Gaps: | 39/228 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 YEDIDDNQIESELDE------SIL------------CPEVKDLPMPSAEKV--------SAPT-- 127
Fly 128 -------SLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRK 185
Fly 186 ELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIH 250
Fly 251 VDARNHYCYVCQKHFKRISHLMTHLSSNIHKRK 283 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | |
| C2H2 Zn finger | 144..164 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 186..211 | CDD:290200 | 12/24 (50%) | ||
| UFD2 | <256..>294 | CDD:227443 | 12/28 (43%) | ||
| C2H2 Zn finger | 258..280 | CDD:275368 | 9/21 (43%) | ||
| ZKSCAN4 | NP_061983.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 34..55 | ||||
| SCAN | 49..160 | CDD:128708 | |||
| KRAB | 221..281 | CDD:214630 | 10/46 (22%) | ||
| zf-C2H2 | 320..342 | CDD:306579 | 5/21 (24%) | ||
| C2H2 Zn finger | 322..342 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 335..357 | CDD:316026 | 7/23 (30%) | ||
| C2H2 Zn finger | 350..370 | CDD:275368 | 6/21 (29%) | ||
| COG5048 | <374..544 | CDD:227381 | 35/86 (41%) | ||
| C2H2 Zn finger | 378..398 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 406..426 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 434..454 | CDD:275368 | 9/21 (43%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 455..480 | 1/3 (33%) | |||
| C2H2 Zn finger | 489..509 | CDD:275368 | |||
| C2H2 Zn finger | 517..537 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||