Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061983.2 | Gene: | ZKSCAN4 / 387032 | HGNCID: | 13854 | Length: | 545 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 69/228 - (30%) |
---|---|---|---|
Similarity: | 99/228 - (43%) | Gaps: | 39/228 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 YEDIDDNQIESELDE------SIL------------CPEVKDLPMPSAEKV--------SAPT-- 127
Fly 128 -------SLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRK 185
Fly 186 ELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIH 250
Fly 251 VDARNHYCYVCQKHFKRISHLMTHLSSNIHKRK 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | |
C2H2 Zn finger | 144..164 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 12/24 (50%) | ||
UFD2 | <256..>294 | CDD:227443 | 12/28 (43%) | ||
C2H2 Zn finger | 258..280 | CDD:275368 | 9/21 (43%) | ||
ZKSCAN4 | NP_061983.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 34..55 | ||||
SCAN | 49..160 | CDD:128708 | |||
KRAB | 221..281 | CDD:214630 | 10/46 (22%) | ||
zf-C2H2 | 320..342 | CDD:306579 | 5/21 (24%) | ||
C2H2 Zn finger | 322..342 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 335..357 | CDD:316026 | 7/23 (30%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 6/21 (29%) | ||
COG5048 | <374..544 | CDD:227381 | 35/86 (41%) | ||
C2H2 Zn finger | 378..398 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 406..426 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 434..454 | CDD:275368 | 9/21 (43%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 455..480 | 1/3 (33%) | |||
C2H2 Zn finger | 489..509 | CDD:275368 | |||
C2H2 Zn finger | 517..537 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |